Potassium channel subfamily K member

Annotation
Keyword
  • Cell membrane
  • Cell projection
  • Cytoplasmic vesicle
  • Disulfide bond
  • Endosome
  • Glycoprotein
  • Isopeptide bond
  • Potassium channel
  • Reference proteome
  • Synapse
  • Transmembrane helix
  • Ubl conjugation
Gene Ontology (GO)
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYFHVRWGFSKQAVAIVHAVLLGVITVSCFFFIPAAVFSLLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKEEDQVHIIEHDQMSFSSITDQAASVKEDQKQDEPFVPPQSPAFADGAANQ
Glycosylation Sites
Displaying 1 entry
Position Description PubMed ID GlyTouCan ID Source
95 N-linked (GlcNAc...) asparagine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.1.0

Last updated: December 9, 2024