Cell wall mannoprotein CIS3

Summary
UniProt ID
A6ZQH4
Gene Symbol
  • CIS3
Organism
Saccharomyces cerevisiae YJM789
External Links
Annotation
Keyword
  • Cell wall
  • Cell wall biogenesis/degradation
  • Cleavage on pair of basic residues
  • Glycoprotein
  • Repeat
  • Signal
Gene Ontology (GO)
Displaying 1 entry
GO Term
fungal-type cell wall organization
Displaying all 2 entries
GO Term
extracellular region
fungal-type cell wall
Displaying 1 entry
GO Term
structural constituent of cell wall
Sequence
MQFKNVALAASVAALSATASAEGYTPGEPWSTLTPTGSISCGAAEYTTTFGIAVQAITSSKAKRDVISQIGDGQVQATSAAATDSQVQASSTATPTSSEKISSSASKTSSTNATSSSCATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC
Glycosylation Sites
Displaying entries 1 - 10 of 12 in total
Position Description PubMed ID GlyTouCan ID Source
68 O-linked (Man) serine
78 O-linked (Man) threonine
102 O-linked (Man) serine
103 O-linked (Man) serine
104 O-linked (Man) serine
106 O-linked (Man) serine
108 O-linked (Man) threonine
109 O-linked (Man) serine
111 O-linked (Man) threonine
114 O-linked (Man) threonine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024