GlyCosmos Portal

Submissions

Protein wntless

Summary

UniProt ID: B4L184
Gene Symbol: wls GI11620
Gene ID
Organism: Drosophila mojavensis

External Links

Re-Glyco: B4L184

Annotation

Keyword: Cell membrane Cell projection Endoplasmic reticulum Endosome Glycoprotein Golgi apparatus Postsynaptic cell membrane Reference proteome Segmentation polarity protein Transmembrane helix Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
compound eye morphogenesis	IEA	GO_REF
intracellular protein transport	IEA	GO_REF
segment polarity determination	ISS	GO_REF
segment polarity determination	IEA	GO_REF
imaginal disc-derived leg morphogenesis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

cell-cell signaling via exosome [inference]

trans-synaptic signaling via exosome

synaptic signaling [inference]

trans-synaptic signaling [inference]

trans-synaptic signaling via exosome

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

post-Golgi vesicle-mediated transport [inference]

Golgi to plasma membrane transport [inference]

Golgi to plasma membrane protein transport

vesicle-mediated transport to the plasma membrane [inference]

Golgi to plasma membrane transport [inference]

Golgi to plasma membrane protein transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

establishment of protein localization to membrane [inference]

establishment of protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

vesicle-mediated transport to the plasma membrane [inference]

Golgi to plasma membrane transport [inference]

Golgi to plasma membrane protein transport

export from cell [inference]

secretion by cell [inference]

protein secretion [inference]

Wnt protein secretion

signal release [inference]

Wnt protein secretion

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

periodic partitioning [inference]

segment polarity determination

cuticle pattern formation

developmental process [inference]

anatomical structure morphogenesis [inference]

post-embryonic animal morphogenesis [inference]

imaginal disc-derived wing margin morphogenesis

post-embryonic appendage morphogenesis [inference]

imaginal disc-derived leg morphogenesis

animal organ morphogenesis [inference]

sensory organ morphogenesis [inference]

eye morphogenesis [inference]

compound eye morphogenesis

appendage morphogenesis [inference]

imaginal disc-derived appendage morphogenesis [inference]

imaginal disc-derived leg morphogenesis

post-embryonic appendage morphogenesis [inference]

imaginal disc-derived leg morphogenesis

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport

protein secretion [inference]

Wnt protein secretion

Golgi to plasma membrane protein transport

protein localization to membrane [inference]

protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

protein localization to cell periphery [inference]

protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

protein localization to extracellular region [inference]

protein secretion [inference]

Wnt protein secretion

establishment of localization [inference]

transport [inference]

protein transport [inference]

intracellular protein transport

protein secretion [inference]

Wnt protein secretion

Golgi to plasma membrane protein transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

post-Golgi vesicle-mediated transport [inference]

Golgi to plasma membrane transport [inference]

Golgi to plasma membrane protein transport

vesicle-mediated transport to the plasma membrane [inference]

Golgi to plasma membrane transport [inference]

Golgi to plasma membrane protein transport

secretion [inference]

secretion by cell [inference]

protein secretion [inference]

Wnt protein secretion

signal release [inference]

Wnt protein secretion

intracellular transport [inference]

intracellular protein transport

export from cell [inference]

secretion by cell [inference]

protein secretion [inference]

Wnt protein secretion

signal release [inference]

Wnt protein secretion

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport

protein secretion [inference]

Wnt protein secretion

Golgi to plasma membrane protein transport

establishment of protein localization to extracellular region [inference]

protein secretion [inference]

Wnt protein secretion

establishment of protein localization to membrane [inference]

establishment of protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

establishment of protein localization to membrane [inference]

establishment of protein localization to plasma membrane [inference]

Golgi to plasma membrane protein transport

vesicle-mediated transport to the plasma membrane [inference]

Golgi to plasma membrane transport [inference]

Golgi to plasma membrane protein transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of Wnt protein secretion

regulation of Wnt protein secretion [inference]

positive regulation of Wnt protein secretion

signaling [inference]

cell-cell signaling [inference]

cell-cell signaling via exosome [inference]

trans-synaptic signaling via exosome

synaptic signaling [inference]

trans-synaptic signaling [inference]

trans-synaptic signaling via exosome

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of intracellular protein transport

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of Wnt protein secretion [inference]

positive regulation of Wnt protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of transport [inference]

regulation of intracellular transport [inference]

regulation of intracellular protein transport

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of Wnt protein secretion [inference]

positive regulation of Wnt protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of protein transport [inference]

regulation of intracellular protein transport

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of Wnt protein secretion [inference]

positive regulation of Wnt protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

regulation of intracellular protein transport

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of Wnt protein secretion

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of Wnt protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of Wnt protein secretion

regulation of Wnt protein secretion [inference]

positive regulation of Wnt protein secretion

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of Wnt protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

regulation of intracellular protein transport

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

regulation of Wnt protein secretion [inference]

positive regulation of Wnt protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of Wnt protein secretion

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
Golgi membrane	IEA	GO_REF GO_REF
early endosome	IEA	GO_REF
multivesicular body	IEA	GO_REF
endoplasmic reticulum membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

plasma membrane region [inference]

synaptic membrane [inference]

cell junction [inference]

synapse [inference]

neuromuscular junction

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

late endosome [inference]

multivesicular body

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

late endosome [inference]

multivesicular body

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

late endosome [inference]

multivesicular body

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying **all 2** entries
GO Term	Evidence Code	Reference
Wnt-protein binding	ISS	GO_REF
Wnt-protein binding	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

Wnt-protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSGTILENLSGRKLSILVSSLLLCQVACFLIGGLYAPVPAGHQIVMGIKCRDVAGRQNDTSFFLYSRGNGACDSVQDIDIEQDPLKMANQLVYVFQMPLPRDNRTLDYSRWQQNLIGVLQMDIAYDSSSELREPPKELQLTIDTRLAYRNKNDEDADWKPYAHSIEKRFLDCRAAHVGLQEILYTCDIIPLFELGALHHSFYLLNLRFPMDTPKRLNLQFGHMHDIILTAIHQNGGFTQVWLLLKSVLFPFIIGIMVWFWRRVHILQRSPALLEYMLLYLGGALSFLNLPLEYLTLSFEMPYMLLLSDVRQGIFYAMLLSFWLVFAGEHMLIQDSPNKSTIRSRYWKHLSAVVVGCISLFVFDICERGMQLRNPFYSIWTTPLGAKVAMSFIVLAGVSAGIYFLFLCYMVWKVFKDIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAGLTVAGFIMGQMAEGHWKWNEDIEIQLTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMRHSDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
58	N-linked (GlcNAc...) asparagine			UniProt
103	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements