GlyCosmos Portal

Submissions

Peroxiredoxin-6

Summary

UniProt ID: O08709
Gene Symbol: Prdx6 Aop2 Ltw4 Prdx5
Gene ID: 11758
Organism: Mus musculus (house mouse)

External Links

GlyGen: O08709
PubChem: O08709
The O-GlcNAc Database: O08709
RaftProt: O08709
O-GlcNAcAtlas: O08709
Re-Glyco: O08709

Annotation

Keyword: Acetylation Antioxidant Cytoplasm Direct protein sequencing Hydrolase Lipid degradation Lysosome Multifunctional enzyme Peroxidase Phosphoprotein Redox-active center Reference proteome Transferase

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
response to reactive oxygen species	IMP	PMID
response to oxidative stress	ISO	GO_REF
response to oxidative stress	IEA	GO_REF
bleb assembly	IMP	PMID
hydrogen peroxide catabolic process	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

glycerophospholipid catabolic process

phospholipid catabolic process [inference]

glycerophospholipid catabolic process

organophosphate catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process

catabolic process [inference]

lipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process

glycerolipid catabolic process [inference]

glycerophospholipid catabolic process

hydrogen peroxide catabolic process

organophosphate catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

glycerophospholipid catabolic process

phospholipid catabolic process [inference]

glycerophospholipid catabolic process

lipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process

glycerolipid catabolic process [inference]

glycerophospholipid catabolic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

glycerophospholipid catabolic process

glycerolipid catabolic process [inference]

glycerophospholipid catabolic process

reactive oxygen species metabolic process [inference]

hydrogen peroxide metabolic process [inference]

hydrogen peroxide catabolic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

plasma membrane bounded cell projection organization [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

cellular detoxification [inference]

cellular oxidant detoxification

homeostatic process [inference]

cellular homeostasis [inference]

cell redox homeostasis

response to stimulus [inference]

response to stress [inference]

response to oxidative stress

response to reactive oxygen species

response to chemical [inference]

response to oxygen-containing compound [inference]

response to reactive oxygen species

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

detoxification [inference]

cellular detoxification [inference]

cellular oxidant detoxification

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF
cytoplasm	ISO	GO_REF GO_REF
cytoplasm	IEA	GO_REF
mitochondrion	HDA	PMID
lysosome	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
peroxidase activity	IMP	PMID
peroxidase activity	IBA	GO_REF
peroxidase activity	IEA	GO_REF
glutathione peroxidase activity	ISO	GO_REF GO_REF
A2-type glycerophospholipase activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on peroxide as acceptor [inference]

peroxidase activity

transferase activity [inference]

acyltransferase activity [inference]

acyltransferase activity, transferring groups other than amino-acyl groups [inference]

1-acylglycerophosphocholine O-acyltransferase activity

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity [inference]

A2-type glycerophospholipase activity

carboxylic ester hydrolase activity [inference]

A2-type glycerophospholipase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

identical protein binding

antioxidant activity [inference]

peroxidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites