GlyCosmos Portal

Submissions

Interleukin-1 receptor antagonist protein

Summary

UniProt ID: O18999
Gene Symbol: IL1RN IL1RA
Gene ID: 100034236
Organism: Equus caballus (horse)

External Links

PubChem: O18999
Re-Glyco: O18999

Annotation

Keyword: Disulfide bond Glycoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
inflammatory response	IBA	GO_REF
inflammatory response	IEA	GO_REF
immune response	IBA	GO_REF
immune response	IEA	GO_REF
negative regulation of interleukin-1-mediated signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

regulation of interleukin-1-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of interleukin-1-mediated signaling pathway

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF
interleukin-1 receptor binding	IEA	GO_REF
interleukin-1 receptor antagonist activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

growth factor receptor binding [inference]

interleukin-1 receptor binding

growth factor binding [inference]

interleukin-1 binding [inference]

interleukin-1 receptor antagonist activity

cytokine binding [inference]

interleukin-1 binding [inference]

interleukin-1 receptor antagonist activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

signaling receptor inhibitor activity [inference]

receptor antagonist activity [inference]

interleukin-1 receptor antagonist activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function inhibitor activity [inference]

signaling receptor inhibitor activity [inference]

receptor antagonist activity [inference]

interleukin-1 receptor antagonist activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEIRRRSVRHLISLLLFLFYSETACHPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites