GlyCosmos Portal

Submissions

Cyclic AMP-responsive element-binding protein 3

Summary

UniProt ID: O43889
Gene Symbol: CREB3 LZIP
Gene ID: 10488
Organism: Homo sapiens (human)

External Links

GlyGen: O43889
PubChem: O43889
The Human Metabolome Database: HMDBP08122
Re-Glyco: O43889

Annotation

Keyword: Activator Alternative splicing Chemotaxis Cytoplasm DNA-binding Endoplasmic reticulum Glycoprotein Golgi apparatus Host-virus interaction Nucleus Proteomics identification Reference proteome Repeat Repressor Signal-anchor Transcription regulation Transmembrane helix Unfolded protein response

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of cell growth	IDA	PMID
DNA-templated transcription	IDA	PMID
transcription, DNA-templated	IDA	PMID
regulation of transcription by RNA polymerase II	NAS	PMID PMID
regulation of transcription by RNA polymerase II	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

endoplasmic reticulum unfolded protein response

intracellular signaling cassette [inference]

integrated stress response signaling

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

endoplasmic reticulum unfolded protein response

integrated stress response signaling

viral process [inference]

release from viral latency

locomotion [inference]

taxis [inference]

chemotaxis

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

endoplasmic reticulum unfolded protein response

integrated stress response signaling

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

endoplasmic reticulum unfolded protein response

integrated stress response signaling

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

positive regulation of calcium ion transport

positive regulation of monoatomic ion transport [inference]

positive regulation of calcium ion transport

positive regulation of transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of calcium ion transport

regulation of growth [inference]

regulation of cell growth

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of positive chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of calcium ion transport

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of cell cycle

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of positive chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

endoplasmic reticulum unfolded protein response

intracellular signaling cassette [inference]

integrated stress response signaling

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of cell cycle

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of cell growth

regulation of cell cycle [inference]

negative regulation of cell cycle

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to endoplasmic reticulum stress [inference]

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of monocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of monocyte chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of monocyte chemotaxis

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of deacetylase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of deacetylase activity

regulation of deacetylase activity [inference]

positive regulation of deacetylase activity

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	TAS	Reactome
Golgi membrane	IDA	PMID
chromatin	ISA	GO_REF
nucleus	EXP	PMID
nucleus	NAS	PMID PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

RNA polymerase II transcription regulator complex

nuclear protein-containing complex [inference]

RNA polymerase II transcription regulator complex

cellular anatomical structure [inference]

membrane

organelle membrane [inference]

endoplasmic reticulum membrane

bounding membrane of organelle [inference]

Golgi membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular membraneless organelle [inference]

nuclear body

cell body [inference]

neuronal cell body

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	PMID PMID
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	PMID
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

chromatin binding

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

chemokine receptor binding [inference]

CCR chemokine receptor binding [inference]

CCR1 chemokine receptor binding

cytokine receptor binding [inference]

chemokine receptor binding [inference]

CCR chemokine receptor binding [inference]

CCR1 chemokine receptor binding

transcription factor binding [inference]

transcription coregulator binding

DNA-binding transcription factor binding [inference]

cAMP response element binding protein binding

identical protein binding

protein homodimerization activity

protein dimerization activity

protein homodimerization activity

transcription regulator activity [inference]

DNA-binding transcription factor activity

DNA-binding transcription factor activity, RNA polymerase II-specific

DNA-binding transcription activator activity, RNA polymerase II-specific

DNA-binding transcription activator activity [inference]

DNA-binding transcription activator activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites