Lectin-like protein EP153R

Summary
External Links
Annotation
Keyword
  • Disulfide bond
  • Early protein
  • Glycoprotein
  • Host endoplasmic reticulum
  • Host membrane
  • Late protein
  • Lectin
  • Modulation of host cell apoptosis by virus
  • Signal-anchor
  • Transmembrane helix
Gene Ontology (GO)
Displaying all 2 entries
GO Term
membrane
host cell endoplasmic reticulum membrane
Displaying 1 entry
GO Term
carbohydrate binding
Sequence
MYFKKKYIGLIDKNCEKKILDDCTTIKICYILIGILIGTNMITLIYNFIFWDHYMTCNKKDKMFYCPKDWVGYNNVCYYFNNDSKNYTTATNSCKQLNSTLANNDTNLLNLTKVYHHDKLYWVNYSLNDNFSLSLRNSTYEKRSKYLPLLFICSK
Glycosylation Sites
Displaying all 8 entries
Position Description PubMed ID GlyTouCan ID Source
82 N-linked (GlcNAc...) asparagine; by host
86 N-linked (GlcNAc...) asparagine; by host
98 N-linked (GlcNAc...) asparagine; by host
104 N-linked (GlcNAc...) asparagine; by host
110 N-linked (GlcNAc...) asparagine; by host
124 N-linked (GlcNAc...) asparagine; by host
130 N-linked (GlcNAc...) asparagine; by host
137 N-linked (GlcNAc...) asparagine; by host
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024