GlyCosmos Portal

Glycoprotein hormones alpha chain

UniProt ID

P01219

Gene Symbol

Gene ID

406869

Organism

Sus scrofa (pig)

Keyword

Displaying **all 2** entries
GO Term
extracellular space
follicle-stimulating hormone complex

Subcellular Location(GO Annotation)

Subcellular in which this glycoprotein is expressed are highlighted in blue.

Displaying **all 4** entries
GO Term
thyroid hormone generation
G protein-coupled receptor signaling pathway
regulation of signaling receptor activity
positive regulation of steroid biosynthetic process

Displaying 1 entry
GO Term
follicle-stimulating hormone activity

Annotation information from UniProt.

Sequence

MDYYRKYAAVILAILSVFLQILHSFPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	Source
67			GlyGen
80	N-linked (GlcNAc...) asparagine	4770796	UniProt GlyGen
106	N-linked (GlcNAc...) asparagine	4770796	UniProt GlyGen

Feature

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Androgen biosynthesis	Sus scrofa
G alpha (s) signalling events	Sus scrofa
Glycoprotein hormones	Sus scrofa
Hormone ligand-binding receptors	Sus scrofa
Mineralocorticoid biosynthesis	Sus scrofa
Reactions specific to the complex N-glycan synthesis pathway	Sus scrofa
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors	Sus scrofa
Thyroxine biosynthesis	Sus scrofa