GlyCosmos Portal

Hemoglobin subunit alpha

UniProt ID

P01942

Gene Symbol

Organism

Mus musculus (house mouse)

Keyword

Displaying **all 8** entries
GO Term
in utero embryonic development
response to bacterium
oxygen transport
nitric oxide transport
erythrocyte development
carbon dioxide transport
response to stilbenoid
hydrogen peroxide catabolic process

Displaying **all 4** entries
GO Term
haptoglobin-hemoglobin complex
hemoglobin complex
blood microparticle
myelin sheath

Displaying **all 10** entries
GO Term
protein-containing complex binding
oxygen binding
organic acid binding
heme binding
haptoglobin binding
peroxidase activity
amyloid-beta binding
oxygen carrier activity
G protein-coupled receptor binding
iron ion binding

Annotation information from UniProt.

Sequence

MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
53			G49108TO	GlyGen
			G49108TO	GlyGen The O-GlcNAc Database

Feature

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Cytoprotection by HMOX1	Mus musculus
Erythrocytes take up carbon dioxide and release oxygen	Mus musculus
Erythrocytes take up oxygen and release carbon dioxide	Mus musculus
Heme signaling	Mus musculus
Scavenging of heme from plasma	Mus musculus