GlyCosmos Portal

Submissions

Major surface glycoprotein G

Summary

UniProt ID: P03423
Gene Symbol: G
Gene ID
Organism: Human respiratory syncytial virus A2

External Links

Re-Glyco: P03423

Annotation

Keyword: 3D-structure Alternative initiation Direct protein sequencing Disulfide bond Glycoprotein Host cell membrane Secreted Transmembrane helix Viral attachment to host adhesion receptor Viral immunoevasion

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
symbiont entry into host cell	IEA	GO_REF
adhesion receptor-mediated virion attachment to host cell	IEA	GO_REF

GO Hierarchy

biological process

biological process involved in interspecies interaction between organisms [inference]

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

adhesion of symbiont to host [inference]

adhesion of symbiont to host cell [inference]

virion attachment to host cell [inference]

receptor-mediated virion attachment to host cell [inference]

adhesion receptor-mediated virion attachment to host cell

symbiont entry into host [inference]

symbiont entry into host cell

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	TAS	Reactome Reactome Reactome
extracellular region	IEA	GO_REF
plasma membrane	TAS	Reactome Reactome Reactome
host cell plasma membrane	EXP	PMID PMID

GO Hierarchy

cellular component

virion component [inference]

virion membrane

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

other organism part [inference]

host cellular component [inference]

host cell part [inference]

host cell membrane [inference]

host cell plasma membrane

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAMIISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 33 in total

1

2

3

4

Next ›

Last »
Position	Description	PubMed ID	Source
70	O-linked (GalNAc...) threonine; by host	8207828	UniProt
72	O-linked (GalNAc...) threonine; by host	8207828	UniProt
80	O-linked (GalNAc...) threonine; by host	8207828	UniProt
86	O-linked (GalNAc...) threonine; by host	8207828	UniProt
87	O-linked (GalNAc...) threonine; by host	8207828	UniProt
92	O-linked (GalNAc...) threonine; by host	8207828	UniProt
100	O-linked (GalNAc...) serine; by host		UniProt
105	O-linked (GalNAc...) serine; by host		UniProt
113	O-linked (GalNAc...) threonine; by host		UniProt
117	O-linked (GalNAc...) serine; by host		UniProt