Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms
Matrix protein 2
Summary
- UniProt ID
- P06821
- Gene Symbol
-
- M
- Organism
- Influenza A virus (A/Puerto Rico/8/1934(H1N1))
External Links
- PubChem
- P06821
Annotation
- Keyword
-
- 3D-structure
- Alternative splicing
- Disulfide bond
- Glycoprotein
- Host cell membrane
- Hydrogen ion transport
- Inhibition of host autophagy by virus
- Palmitate
- Phosphoprotein
- Reference proteome
- Signal-anchor
- Transmembrane helix
- Viral ion channel
- Virion
- Gene Ontology (GO)
| GO Term |
|---|
| uncoating of virus |
| pore-mediated entry of viral genome into host cell |
| suppression by virus of host autophagy |
| protein complex oligomerization |
| GO Term |
|---|
| host cell plasma membrane |
| virion membrane |
| extracellular region |
| plasma membrane |
| GO Term |
|---|
| monoatomic ion channel activity |
| proton transmembrane transporter activity |
Sequence
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 20 | N-linked (GlcNAc...) asparagine; by host |
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Assembly of Viral Components at the Budding Site | Homo sapiens |
| Budding | Homo sapiens |
| Entry of Influenza Virion into Host Cell via Endocytosis | Homo sapiens |
| Fusion of the Influenza Virion to the Host Cell Endosome | Homo sapiens |
| Influenza Infection | Homo sapiens |
| Packaging of Eight RNA Segments | Homo sapiens |
| Release | Homo sapiens |
| Transport of HA trimer, NA tetramer and M2 tetramer from the endoplasmic reticulum to the Golgi Apparatus | Homo sapiens |
| Uncoating of the Influenza Virion | Homo sapiens |
| Viral mRNA Translation | Homo sapiens |
