GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Saccharopepsin

Summary

UniProt ID: P07267
Gene Symbol: PEP4 P2585 PHO9 PRA1 YPL154C
Gene ID: 855949
Organism: Saccharomyces cerevisiae S288C

External Links

PubChem: P07267
Re-Glyco: P07267

Annotation

Keyword: 3D-structure Aspartyl protease Direct protein sequencing Disulfide bond Glycoprotein Reference proteome Signal Vacuole Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
pexophagy	IMP	PMID
autophagy	IMP	PMID
macroautophagy	IMP	PMID
microautophagy	IMP	PMID
cytoplasm to vacuole targeting by the Cvt pathway	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

pexophagy

microautophagy

autophagy of peroxisome [inference]

pexophagy

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

vacuolar transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

process utilizing autophagic mechanism [inference]

pexophagy

microautophagy

autophagy of peroxisome [inference]

pexophagy

cytoplasm to vacuole targeting by the Cvt pathway

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

protein localization to organelle [inference]

protein localization to vacuole [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

establishment of localization [inference]

transport [inference]

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

vacuolar transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

establishment of protein localization [inference]

protein targeting [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

establishment of protein localization to organelle [inference]

establishment of protein localization to vacuole [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

vacuolar transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

vacuolar transport [inference]

protein targeting to vacuole [inference]

cytoplasm to vacuole targeting by the Cvt pathway

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fungal-type vacuole	IDA	PMID
fungal-type vacuole	IBA	GO_REF
fungal-type vacuole	IEA	GO_REF
fungal-type vacuole	HDA	PMID
mitochondrion	HDA	PMID PMID PMID

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

vacuole [inference]

storage vacuole [inference]

fungal-type vacuole

lytic vacuole [inference]

fungal-type vacuole

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

vacuole [inference]

storage vacuole [inference]

fungal-type vacuole

lytic vacuole [inference]

fungal-type vacuole

endoplasmic reticulum

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
aspartic-type endopeptidase activity	IDA	PMID PMID
aspartic-type endopeptidase activity	IBA	GO_REF
aspartic-type endopeptidase activity	IEA	GO_REF GO_REF
peptidase activity	IDA	PMID
oligosaccharide binding	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

binding [inference]

protein binding [inference]

protein domain specific binding [inference]

disordered domain specific binding

carbohydrate binding [inference]

oligosaccharide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
144	N-linked (GlcNAc...) asparagine			UniProt
345	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
MHC class II antigen presentation	Saccharomyces cerevisiae
Neutrophil degranulation	Saccharomyces cerevisiae

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026