Uncharacterized protein UL116

Summary
UniProt ID
P16833
Gene Symbol
  • UL116
Organism
Human herpesvirus 5 strain AD169
External Links
Annotation
Keyword
  • Glycoprotein
  • Host endoplasmic reticulum
  • Reference proteome
  • Signal
  • Virion
Gene Ontology (GO)
Displaying all 2 entries
GO Term
virion component
host cell endoplasmic reticulum
Sequence
MKRRRRWRGWLLFPALCFCLLCEAVETNATTVTSTTAAAATTNTTVATTGTTTTSPNVTSTTSNTVTTPTTVSSVSNLTSSTTSIPISTSTVSGTRNTGNNNTTTIGTNATSPSPSVSILTTVTPAATSTISVDGVVTASDYTPTFDDLENITTTRAPTRPPAQDLCSHNLSIILYEEESQSSVDIAVDEEEPELEDDDEYDELWFPLYFEAECNRNYTLHVNHSCDYSVRQSSVSFPPWRDIDSVTFVPRNLSNCSAHGLAVIVAGNQTWYVNPFSLAHLLDAIYNVLGIEDLSANFRRQLAPYRHTLIVPQT
Glycosylation Sites
Displaying entries 1 - 10 of 14 in total
Position Description PubMed ID GlyTouCan ID Source
28 N-linked (GlcNAc...) asparagine; by host
43 N-linked (GlcNAc...) asparagine; by host
57 N-linked (GlcNAc...) asparagine; by host
77 N-linked (GlcNAc...) asparagine; by host
101 N-linked (GlcNAc...) asparagine; by host
102 N-linked (GlcNAc...) asparagine; by host
109 N-linked (GlcNAc...) asparagine; by host
151 N-linked (GlcNAc...) asparagine; by host
170 N-linked (GlcNAc...) asparagine; by host
217 N-linked (GlcNAc...) asparagine; by host
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024