GlyCosmos Portal

Submissions

Lymphocyte function-associated antigen 3

Summary

UniProt ID: P19256
Gene Symbol: CD58 LFA3
Gene ID: 965
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011583

GlyConnect

Lymphocyte function-associated antigen 3

GlyGen

P19256

PubChem

P19256

The O-GlcNAc Database

P19256

RaftProt

P19256

Re-Glyco

P19256

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Immunoglobulin domain Proteomics identification Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response	IBA	GO_REF
positive regulation of interleukin-8 production	IMP	PMID
heterotypic cell-cell adhesion	IDA	PMID
heterotypic cell-cell adhesion	IBA	GO_REF
cellular response to type II interferon	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion

heterotypic cell-cell adhesion

response to stimulus [inference]

immune response

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

response to type II interferon [inference]

cellular response to type II interferon

response to tumor necrosis factor [inference]

cellular response to tumor necrosis factor

cellular response to cytokine stimulus [inference]

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	NAS	PMID
plasma membrane	TAS	Reactome Reactome Reactome
plasma membrane	IEA	GO_REF
cell surface	IDA	PMID
cell surface	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

secretory granule membrane

ficolin-1-rich granule membrane

bounding membrane of organelle [inference]

secretory granule membrane

ficolin-1-rich granule membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying **all 2** entries
GO Term	Evidence Code	Reference
signaling receptor binding	IBA	GO_REF
signaling receptor binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
40	N-linked (GlcNAc...) asparagine			UniProt GlyGen
94	N-linked (GlcNAc...) asparagine			UniProt GlyGen
109	N-linked (GlcNAc...) asparagine			UniProt GlyGen
135	N-linked (GlcNAc...) asparagine		G36921VW	UniProt GlyGen
169	N-linked (GlcNAc...) asparagine	23090970 24190977 29741879 37074911	G11738SE G93718GY G10773YW G80920RR G62765YT	GlycoProtDB UniProt GlyGen GlyConnect
188		38253038 40596516	G49108TO	The O-GlcNAc Database
195	N-linked (GlcNAc...) asparagine	24190977	G34989PA	UniProt GlyGen