GlyCosmos Portal

Submissions

Soluble interferon alpha/beta receptor OPG204

Summary

UniProt ID: P21077
Gene Symbol: OPG204 B19R
Gene ID
Organism: Vaccinia virus Copenhagen

External Links

Re-Glyco: P21077

Annotation

Keyword: Disulfide bond Early protein Glycoprotein Immunoglobulin domain Inhibition of host interferon signaling pathway by virus Repeat Secreted Signal

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
symbiont-mediated suppression of host type I interferon-mediated signaling pathway	IEA	GO_REF
symbiont-mediated suppression of host innate immune response	IEA	GO_REF

GO Hierarchy

biological process

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

symbiont-mediated perturbation of host process [inference]

symbiont-mediated perturbation of host cellular process [inference]

symbiont-mediated perturbation of host signal transduction pathway [inference]

symbiont-mediated suppression of host signal transduction pathway [inference]

symbiont-mediated suppression of host interferon-mediated signaling pathway [inference]

symbiont-mediated suppression of host type I interferon-mediated signaling pathway

symbiont-mediated perturbation of host defense response [inference]

symbiont-mediated perturbation of host immune response [inference]

symbiont-mediated perturbation of host innate immune response [inference]

symbiont-mediated suppression of host innate immune response

symbiont-mediated suppression of host immune response [inference]

symbiont-mediated suppression of host innate immune response

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

symbiont-mediated perturbation of host process [inference]

symbiont-mediated perturbation of host cellular process [inference]

symbiont-mediated perturbation of host signal transduction pathway [inference]

symbiont-mediated suppression of host signal transduction pathway [inference]

symbiont-mediated suppression of host interferon-mediated signaling pathway [inference]

symbiont-mediated suppression of host type I interferon-mediated signaling pathway

symbiont-mediated perturbation of host defense response [inference]

symbiont-mediated perturbation of host immune response [inference]

symbiont-mediated perturbation of host innate immune response [inference]

symbiont-mediated suppression of host innate immune response

symbiont-mediated suppression of host immune response [inference]

symbiont-mediated suppression of host innate immune response

Displaying **all 2** entries
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTMKMMVHIYFVSLSLLLLLFHSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDMATLGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIKKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
119	N-linked (GlcNAc...) asparagine; by host	UniProt
184	N-linked (GlcNAc...) asparagine; by host	UniProt
263	N-linked (GlcNAc...) asparagine; by host	UniProt
271	N-linked (GlcNAc...) asparagine; by host	UniProt
323	N-linked (GlcNAc...) asparagine; by host	UniProt