GlyCosmos Portal

Submissions

CCAAT/enhancer-binding protein beta

Summary

UniProt ID: P21272
Gene Symbol: Cebpb Crp2 Nf-il6 Sfb
Gene ID: 24253
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P21272
PubChem: P21272
Re-Glyco: P21272

Annotation

Keyword: Acetylation Activator Alternative initiation Cytoplasm DNA-binding Differentiation Glycoprotein Isopeptide bond Methylation Nucleus Phosphoprotein Reference proteome Transcription regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 82 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID
ovarian follicle development	ISS	GO_REF
ovarian follicle development	ISO	GO_REF
ovarian follicle development	IEA	GO_REF
liver development	IEP	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

granuloma formation

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

T-helper 1 cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

T-helper 1 cell activation

signal transduction [inference]

intracellular signal transduction [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

cell population proliferation [inference]

epithelial cell proliferation [inference]

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

epithelial cell differentiation [inference]

mammary gland epithelial cell differentiation

fat cell differentiation

brown fat cell differentiation

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

T-helper 1 cell activation

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

memory

behavior [inference]

learning or memory [inference]

memory

developmental process [inference]

anatomical structure development [inference]

regeneration [inference]

animal organ regeneration [inference]

liver regeneration

animal gross anatomical part developmental process [inference]

ovarian follicle development

animal organ development [inference]

animal organ regeneration [inference]

liver regeneration

embryonic organ development [inference]

embryonic placenta development

gland development [inference]

liver development

liver regeneration

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

epithelial cell differentiation [inference]

mammary gland epithelial cell differentiation

fat cell differentiation

brown fat cell differentiation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

cellular response to stress [inference]

response to endoplasmic reticulum stress

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to chemical [inference]

response to acid chemical [inference]

response to amino acid [inference]

cellular response to amino acid stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

response to lipid [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

response to peptide [inference]

response to cytokine [inference]

response to interleukin-1 [inference]

cellular response to interleukin-1

cellular response to cytokine stimulus [inference]

cellular response to interleukin-1

response to oxygen-containing compound [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of dendritic cell differentiation

regulation of localization [inference]

regulation of transport [inference]

regulation of phosphate transport [inference]

regulation of sodium-dependent phosphate transport [inference]

positive regulation of sodium-dependent phosphate transport

positive regulation of transport [inference]

positive regulation of sodium-dependent phosphate transport

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell differentiation [inference]

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response

positive regulation of transport [inference]

positive regulation of sodium-dependent phosphate transport

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of biomineral tissue development

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of cold-induced thermogenesis

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response

regulation of inflammatory response [inference]

positive regulation of inflammatory response

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response

regulation of inflammatory response [inference]

positive regulation of inflammatory response

regulation of developmental process [inference]

regulation of cell differentiation

regulation of epithelial cell differentiation [inference]

regulation of odontoblast differentiation

positive regulation of cell differentiation [inference]

regulation of fat cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of osteoblast differentiation [inference]

positive regulation of osteoblast differentiation

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of dendritic cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of biomineral tissue development

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of odontoblast differentiation

regulation of biomineral tissue development [inference]

positive regulation of biomineral tissue development

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of dendritic cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-4 production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-6 production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-4 production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-6 production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of cell differentiation

regulation of epithelial cell differentiation [inference]

regulation of odontoblast differentiation

positive regulation of cell differentiation [inference]

regulation of fat cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of osteoblast differentiation [inference]

positive regulation of osteoblast differentiation

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of dendritic cell differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell differentiation [inference]

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-4 production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-6 production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of cold-induced thermogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cold-induced thermogenesis [inference]

positive regulation of cold-induced thermogenesis

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of odontoblast differentiation

regulation of biomineral tissue development [inference]

positive regulation of biomineral tissue development

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

regulation of osteoclast differentiation

regulation of dendritic cell differentiation

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
condensed chromosome, centromeric region	ISO	GO_REF
condensed chromosome, centromeric region	IEA	GO_REF
chromatin	ISO	GO_REF
chromatin	IEA	GO_REF
nucleus	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

RNA polymerase II transcription regulator complex

nuclear protein-containing complex [inference]

RNA polymerase II transcription regulator complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

chromosomal region [inference]

chromosome, centromeric region [inference]

condensed chromosome, centromeric region

Displaying entries **1 - 5** of 46 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	ISO	GO_REF
transcription cis-regulatory region binding	IEA	GO_REF
RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISO	GO_REF
RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	GO_REF
RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

core promoter sequence-specific DNA binding [inference]

RNA polymerase II core promoter sequence-specific DNA binding

DNA binding

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

core promoter sequence-specific DNA binding [inference]

RNA polymerase II core promoter sequence-specific DNA binding

chromatin DNA binding

sequence-specific DNA binding

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

core promoter sequence-specific DNA binding [inference]

RNA polymerase II core promoter sequence-specific DNA binding

chromatin binding

chromatin DNA binding

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding

RNA polymerase II-specific DNA-binding transcription factor binding

nuclear receptor binding [inference]

nuclear glucocorticoid receptor binding

enzyme binding [inference]

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

transcription regulator activity [inference]

DNA-binding transcription factor activity [inference]

DNA-binding transcription factor activity, RNA polymerase II-specific

DNA-binding transcription activator activity [inference]

DNA-binding transcription activator activity, RNA polymerase II-specific

DNA-binding transcription repressor activity [inference]

DNA-binding transcription repressor activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
170		GlyGen
181	O-linked (GlcNAc) serine	UniProt GlyGen
182	O-linked (GlcNAc) serine	UniProt GlyGen
189		GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Senescence-Associated Secretory Phenotype (SASP)	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements