Major surface glycoprotein G

Summary
Re-Glyco
P22261
Annotation
Keyword
  • 3D-structure
  • Alternative initiation
  • Disulfide bond
  • Glycoprotein
  • Host cell membrane
  • Secreted
  • Transmembrane helix
  • Viral attachment to host cell
  • Viral immunoevasion
Gene Ontology (GO)
Subcellular Location(GO Annotation)

Subcellular in which this glycoprotein is expressed are highlighted in blue.

Sequence
MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALSTLAMITLTSLVITAIIYISVGNAKAKPTSKPTIQQTQQPQNHTSPFFTEHNYKSTHTSIQSTTLSQLLNIDTTRGITYGHSTNETQNRKIKGQSTLPATRKPPINPSGSIPPENHQDHNNFQTLPYVPCSTCEGNLACLSLCHIETERAPSRAPTITLKKTPKPKTTKKPTKTTIHHRTSPETKLQPKNNTATPQQGILSSTEHHTNQSTTQI
Glycosylation Sites
Displaying entries 1 - 10 of 13 in total
Position Description PubMed ID GlyTouCan ID Source
72 O-linked (GalNAc...) threonine; by host
80 O-linked (GalNAc...) threonine; by host
85 N-linked (GlcNAc...) asparagine; by host
87 O-linked (GalNAc...) threonine; by host
92 O-linked (GalNAc...) threonine; by host
105 O-linked (GalNAc...) serine; by host
127 N-linked (GlcNAc...) asparagine; by host
139 O-linked (GalNAc...) threonine; by host
199 O-linked (GalNAc...) threonine; by host
215 O-linked (GalNAc...) threonine; by host
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: [email protected]

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.5.0

Last updated: April 6, 2026