GlyCosmos Portal

Submissions

Alpha-crystallin B chain

Summary

UniProt ID: P23928
Gene Symbol: Cryab
Gene ID: 25420
Organism: Rattus norvegicus (Norway rat)

External Links

GlyConnect

Alpha crystallin - a and b chains

GlyGen

P23928

PubChem

P23928

The O-GlcNAc Database

P23928

O-GlcNAcAtlas

P23928

Re-Glyco

P23928

Annotation

Keyword: Acetylation Chaperone Cytoplasm Direct protein sequencing Eye lens protein Glycoprotein Lysosome Metal-binding Methylation Nucleus Phosphoprotein Reference proteome Secreted Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 38 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
response to hypoxia	ISO	GO_REF
lens development in camera-type eye	ISO	GO_REF
protein folding	IDA	PMID
glutathione metabolic process	ISO	GO_REF
tubulin complex assembly	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

protein folding

protein refolding

microtubule-based process [inference]

microtubule cytoskeleton organization [inference]

microtubule polymerization or depolymerization

signal transduction [inference]

intracellular signal transduction [inference]

stress-activated protein kinase signaling cascade [inference]

stress-activated MAPK cascade

intracellular signaling cassette [inference]

MAPK cascade [inference]

stress-activated MAPK cascade

metabolic process [inference]

modified amino acid metabolic process [inference]

glutathione metabolic process

sulfur compound metabolic process [inference]

glutathione metabolic process

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

apoptotic process involved in development [inference]

apoptotic process involved in morphogenesis

cellular response to stimulus [inference]

cellular response to stress [inference]

stress-activated protein kinase signaling cascade [inference]

stress-activated MAPK cascade

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization [inference]

microtubule polymerization or depolymerization

cellular component assembly [inference]

protein-containing complex assembly [inference]

tubulin complex assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

tubulin complex assembly

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

lens development in camera-type eye

animal organ development [inference]

sensory organ development [inference]

eye development [inference]

camera-type eye development

muscle organ development

muscle structure development [inference]

muscle organ development

response to stimulus [inference]

response to stress [inference]

response to hypoxia

response to oxidative stress [inference]

response to reactive oxygen species [inference]

response to hydrogen peroxide

response to heat

cellular response to stress [inference]

stress-activated protein kinase signaling cascade [inference]

stress-activated MAPK cascade

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to heat

response to radiation [inference]

response to ionizing radiation [inference]

response to gamma radiation [inference]

cellular response to gamma radiation

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

response to chemical [inference]

response to lipid [inference]

response to estradiol

response to oxygen-containing compound [inference]

response to reactive oxygen species [inference]

response to hydrogen peroxide

response to estradiol

cellular response to stimulus [inference]

cellular response to stress [inference]

stress-activated protein kinase signaling cascade [inference]

stress-activated MAPK cascade

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of intracellular transport [inference]

negative regulation of intracellular transport

negative regulation of transport [inference]

negative regulation of intracellular transport

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

negative regulation of intracellular transport

regulation of growth [inference]

regulation of cell growth [inference]

negative regulation of cell growth

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of biological process [inference]

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of reactive oxygen species metabolic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

negative regulation of transport [inference]

negative regulation of intracellular transport

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

stress-activated protein kinase signaling cascade [inference]

stress-activated MAPK cascade

intracellular signaling cassette [inference]

MAPK cascade [inference]

stress-activated MAPK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of reactive oxygen species metabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of protein metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

regulation of amyloid fibril formation [inference]

negative regulation of amyloid fibril formation

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of protein metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

regulation of amyloid fibril formation [inference]

negative regulation of amyloid fibril formation

regulation of reactive oxygen species metabolic process [inference]

negative regulation of reactive oxygen species metabolic process

regulation of programmed cell death

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of reactive oxygen species metabolic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

regulation of cellular component organization [inference]

regulation of cell growth [inference]

negative regulation of cell growth

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

regulation of supramolecular fiber organization [inference]

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

regulation of amyloid fibril formation [inference]

negative regulation of amyloid fibril formation

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

negative regulation of intracellular transport

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 36 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	IEA	GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

synaptic membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

neuron spine [inference]

dendritic spine

perikaryon

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

contractile muscle fiber

myofibril [inference]

cardiac myofibril

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular membraneless organelle [inference]

contractile muscle fiber

myofibril [inference]

cardiac myofibril

postsynapse [inference]

dendritic spine

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

contractile muscle fiber

myofibril [inference]

cardiac myofibril

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
amyloid-beta binding	ISO	GO_REF
amyloid-beta binding	IEA	GO_REF
structural molecule activity	ISO	GO_REF
structural molecule activity	IEA	GO_REF
structural constituent of eye lens	TAS	PMID

GO Hierarchy

molecular function

structural molecule activity

structural constituent of eye lens

binding [inference]

protein binding [inference]

cytoskeletal protein binding

tubulin binding [inference]

microtubule binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

peptide binding [inference]

amyloid-beta binding

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites