GlyCosmos Portal

Submissions

Decorin

Summary

UniProt ID: P28654
Gene Symbol: Dcn
Gene ID: 13179
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0003535

GlyConnect

Decorin

GlyGen

P28654

PubChem

P28654

Re-Glyco

P28654

Annotation

Keyword: Disulfide bond Extracellular matrix Leucine-rich repeat Proteoglycan Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of autophagy	ISO	GO_REF
positive regulation of autophagy	IEA	GO_REF
negative regulation of endothelial cell migration	ISO	GO_REF
positive regulation of macroautophagy	ISO	GO_REF
negative regulation of angiogenesis	ISO	GO_REF

GO Hierarchy

biological process

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial fission

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of developmental process [inference]

positive regulation of mitochondrial fission

positive regulation of membrane depolarization [inference]

positive regulation of mitochondrial depolarization

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of cellular response to vascular endothelial growth factor stimulus [inference]

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

regulation of mitochondrial fission [inference]

positive regulation of mitochondrial fission

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of mitochondrial fission

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

regulation of membrane depolarization [inference]

regulation of mitochondrial depolarization [inference]

positive regulation of mitochondrial depolarization

positive regulation of membrane depolarization [inference]

positive regulation of mitochondrial depolarization

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

regulation of autophagy [inference]

positive regulation of autophagy

positive regulation of macroautophagy

regulation of macroautophagy [inference]

positive regulation of macroautophagy

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial fission

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial fission

regulation of mitochondrion organization [inference]

regulation of mitochondrial fission [inference]

positive regulation of mitochondrial fission

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial fission

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of biological quality [inference]

regulation of membrane potential [inference]

regulation of membrane depolarization [inference]

regulation of mitochondrial depolarization [inference]

positive regulation of mitochondrial depolarization

positive regulation of membrane depolarization [inference]

positive regulation of mitochondrial depolarization

regulation of mitochondrial membrane potential [inference]

regulation of mitochondrial depolarization [inference]

positive regulation of mitochondrial depolarization

Displaying **all 3** entries
GO Term	Evidence Code	Reference
collagen type VI trimer	ISO	GO_REF
obsolete extracellular space
extracellular matrix	HDA	PMID PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer [inference]

von-Willerbrand-factor-A-domain-rich collagen trimer [inference]

collagen type VI trimer

extracellular protein-containing complex [inference]

collagen type VI trimer

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying **all 3** entries
GO Term	Evidence Code	Reference
collagen binding	ISO	GO_REF
glycosaminoglycan binding	IDA	PMID
extracellular matrix binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein-containing complex binding [inference]

collagen binding

extracellular matrix binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKATLIFFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
34	O-linked (Xyl...) (glycosaminoglycan) serine			UniProt GlyGen
206	N-linked (GlcNAc...) asparagine	30899004	G02815KT G06110VR	GlycoProtDB UniProt GlyGen GlyConnect
241	N-linked (GlcNAc...) asparagine		G92275SC	UniProt GlyGen
257	N-linked (GlcNAc...) asparagine		G42124LM	GlycoProtDB UniProt GlyGen
298	N-linked (GlcNAc...) asparagine		G83633GK	GlycoProtDB UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
CS-GAG biosynthesis	Mus musculus
CS/DS degradation	Mus musculus
DS-GAG biosynthesis	Mus musculus
Degradation of the extracellular matrix	Mus musculus
ECM proteoglycans	Mus musculus
Glycosaminoglycan-protein linkage region biosynthesis	Mus musculus

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:13359	Ehlers-Danlos syndrome	Alliance of Genome Resources
DOID:0060445	congenital stromal corneal dystrophy	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements