GlyCosmos Portal

Submissions

Pigment epithelium-derived factor

Summary

UniProt ID: P36955
Gene Symbol: SERPINF1 PEDF PIG35
Gene ID: 5176
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011666

GlyConnect

Pigment epithelium-derived factor

GlyGen

P36955

PubChem

P36955

RaftProt

P36955

Re-Glyco

P36955

Annotation

Keyword: 3D-structure Direct protein sequencing Dwarfism Glycoprotein Osteogenesis imperfecta Phosphoprotein Proteomics identification Pyrrolidone carboxylic acid Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
kidney development	IEA	GO_REF
short-term memory	IEA	GO_REF
response to acidic pH	IEA	GO_REF
negative regulation of endothelial cell migration	IEA	GO_REF
negative regulation of gene expression	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell population proliferation [inference]

epithelial cell proliferation [inference]

epithelial cell proliferation involved in prostate gland development

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to metal ion [inference]

cellular response to cobalt ion

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

reproductive process [inference]

multicellular organismal reproductive process [inference]

ovulation cycle

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

memory [inference]

short-term memory

behavior [inference]

learning or memory [inference]

memory [inference]

short-term memory

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

animal organ development [inference]

kidney development

retina development in camera-type eye

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

rhythmic process [inference]

ovulation cycle

response to stimulus [inference]

response to abiotic stimulus [inference]

response to pH [inference]

response to acidic pH

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to metal ion [inference]

response to cobalt ion [inference]

cellular response to cobalt ion

cellular response to metal ion [inference]

cellular response to cobalt ion

response to lipid [inference]

response to retinoic acid [inference]

cellular response to retinoic acid

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to arsenic-containing substance

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to metal ion [inference]

cellular response to cobalt ion

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

response to peptide

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose [inference]

cellular response to glucose stimulus

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

response to retinoic acid [inference]

cellular response to retinoic acid

response to ketone [inference]

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to metal ion [inference]

cellular response to cobalt ion

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of developmental process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of reproductive process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis

negative regulation of developmental process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of epithelial cell proliferation involved in prostate gland development [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of reproductive process [inference]

negative regulation of reproductive process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF
extracellular region	HDA	PMID
basement membrane	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

basement membrane

axon hillock

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

perinuclear region of cytoplasm

Displaying **all 2** entries
GO Term	Evidence Code	Reference
serine-type endopeptidase inhibitor activity	IBA	GO_REF
serine-type endopeptidase inhibitor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

serine-type endopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

serine-type endopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

serine-type endopeptidase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

serine-type endopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
24		30459171	G43417UB	GlyGen
30		30459171	G43417UB G29068FM	GlyGen
36		30459171	G43417UB G29068FM	GlyGen
285	N-linked (GlcNAc...) (complex) asparagine	11562499 16335952 19139490 19159218 24279413 29391424 29741879 37074911	G56518TU G70232NH G69521XL G81124ET G70888PK G06247RL G80075MS G57776ZS G77669RF G86880BF G27947YN G90382BL G04854VP G94470IW G43734MM G34989PA G45395BF G88374WZ G59324HL G20706XG G12580WI G43223CG G26330YA G40574BA G08918WF G75983OB G00912UN G48414YA G92551JA G61256FT G08293MJ G27058EU G84452RH G43769HG G10488MI G41071NU G06356OH G37868ZX G59626AS G08290VR G01485JJ G42124LM G23863VK G90659AW G45504EY G62765YT G47950XN G47644PP G10486CT G05049YU G95865ZB G72787SB G11314AS G28681TP	GlycoProtDB UniProt GlyGen GlyConnect
372		30459171	G43417UB G29068FM	GlyGen
374		30459171	G43417UB	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying entries **1 - 10** of 19 in total

1

2

Next ›

Last »
DO ID	Disease Name	Source
DOID:8947	diabetic retinopathy	Alliance of Genome Resources
DOID:0080547	metabolic dysfunction-associated steatohepatitis	Alliance of Genome Resources
DOID:224	transient cerebral ischemia	Alliance of Genome Resources
DOID:13141	uveitis	Alliance of Genome Resources
DOID:289	endometriosis	Alliance of Genome Resources
DOID:10584	retinitis pigmentosa	Alliance of Genome Resources
DOID:11446	sciatic neuropathy	Alliance of Genome Resources
DOID:0110350	osteogenesis imperfecta type 6	Alliance of Genome Resources
DOID:9352	type 2 diabetes mellitus	Alliance of Genome Resources
DOID:9970	obesity	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements