GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Protein Wnt-8b

Summary

UniProt ID: P51029
Gene Symbol: wnt8b wnt-8b
Gene ID: 30144
Organism: Danio rerio (zebrafish)

External Links

PubChem: P51029
Re-Glyco: P51029

Annotation

Keyword: Developmental protein Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Reference proteome Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
eye development
embryonic pattern specification	IEA	GO_REF
Wnt signaling pathway	IEA	GO_REF
hypothalamus development
forebrain neuron differentiation

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

canonical Wnt signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

central nervous system neuron differentiation [inference]

forebrain neuron differentiation

cell fate commitment

cell fate commitment involved in pattern specification [inference]

eye field cell fate commitment involved in camera-type eye formation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance [inference]

commissural neuron axon guidance

multicellular organismal process [inference]

pattern specification process [inference]

embryonic pattern specification

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

ectodermal placode formation [inference]

otic placode formation

anatomical structure development [inference]

regeneration [inference]

tissue regeneration [inference]

epithelium regeneration [inference]

sensory epithelium regeneration

animal gross anatomical part developmental process [inference]

tissue development [inference]

epithelium development [inference]

epithelium regeneration [inference]

sensory epithelium regeneration

tissue regeneration [inference]

epithelium regeneration [inference]

sensory epithelium regeneration

animal organ development [inference]

sensory organ development [inference]

eye development

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

central nervous system neuron differentiation [inference]

forebrain neuron differentiation

cell fate commitment

cell fate commitment involved in pattern specification [inference]

eye field cell fate commitment involved in camera-type eye formation

growth [inference]

developmental growth [inference]

tissue regeneration [inference]

epithelium regeneration [inference]

sensory epithelium regeneration

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

canonical Wnt signaling pathway

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 2** entries
GO Term	Evidence Code	Reference
frizzled binding	IBA	GO_REF
cytokine activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

frizzled binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFMHLEVYYYAFILMAHMKTCCGWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWKCPERALQLSTHSGLRSANRETAFFHAISSAGVMYTLTRNCSLGDFDNCGCDDTRNGQRGGQGWLWGGCSDNVGFGEVISKQFVDALETGQDARAAMNLHNNEVGRKAVKGTMQRTCKCHGVSGSCTTQTCWLQLPEFREVGNYLKEKYHRAVKVDLLRGAGNSAASRGAIAETFNSISRKELVHLEDSPDYCLENRTLGLPGTEGRECLRKGKNLSKWEKRTCKRLCGDCGLAVEERRAETVSSCNCKFHWCCAVKCEQCRKTVTKYYCVKRSKRVKNDNASRRKSYRLKKKH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
104	N-linked (GlcNAc...) asparagine			UniProt
260	N-linked (GlcNAc...) asparagine			UniProt
279	N-linked (GlcNAc...) asparagine			UniProt
345	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Disassembly of the destruction complex and recruitment of AXIN to the membrane	Danio rerio
WNT ligand biogenesis and trafficking	Danio rerio

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026