GlyCosmos Portal

Submissions

SCF ubiquitin ligase complex protein SKP1a

Summary

UniProt ID: P52285
Gene Symbol: fpaA DDB_G0269230 fp21A fpa1 fpa1A skp1A
Gene ID: 8617413
Organism: Dictyostelium discoideum

External Links

GlyConnect

Glycoprotein fp21

GlyGen

P52285

Re-Glyco

P52285

Annotation

Keyword: 3D-structure Acetylation Cytoplasm Direct protein sequencing Glycoprotein Hydroxylation Nucleus Reference proteome Ubl conjugation pathway

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
protein ubiquitination	TAS	PMID
protein ubiquitination	IEA	GO_REF
sorocarp development	IMP	PMID
SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

macromolecule modification [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

developmental process [inference]

anatomical structure development [inference]

socially cooperative development [inference]

sorocarp development

biological process involved in intraspecies interaction between organisms [inference]

socially cooperative development [inference]

sorocarp development

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IDA	PMID
nucleus	IEA	GO_REF
cytoplasm	IDA	PMID
cytoplasm	IEA	GO_REF
cell cortex	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

ubiquitin ligase complex [inference]

cytoplasmic ubiquitin ligase complex [inference]

cytoplasmic SCF ubiquitin ligase complex

cullin-RING ubiquitin ligase complex [inference]

SCF ubiquitin ligase complex [inference]

cytoplasmic SCF ubiquitin ligase complex

catalytic complex [inference]

transferase complex [inference]

ubiquitin ligase complex [inference]

cytoplasmic ubiquitin ligase complex [inference]

cytoplasmic SCF ubiquitin ligase complex

cullin-RING ubiquitin ligase complex [inference]

SCF ubiquitin ligase complex [inference]

cytoplasmic SCF ubiquitin ligase complex

cellular anatomical structure [inference]

cytoplasm

cell cortex

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
identical protein binding	IDA	PMID
identical protein binding	IEA	GO_REF
WD40-repeat domain binding	IPI	PMID
WD40-repeat domain binding	IEA	GO_REF
cullin family protein binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

protein domain specific binding [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSLVKLESSDEKVFEIEKEIACMSVTIKNMIEDIGESDSPIPLPNVTSTILEKVLDYCRHHHQHPSPQGDDKKDEKRLDDIPPYDRDFCKVDQPTLFELILAANYLDIKPLLDVTCKTVANMIRGKTPEEIRKIFNIKNDFTPEEEEQIRKENEWCEDKGGN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
143	O-linked (GlcNAc...) hydroxyproline	12244067 9660787	G05897GU G25363YF	UniProt GlyConnect
unknown		11358877	G05897GU G23721DM	GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Antigen processing: Ubiquitination & Proteasome degradation	Dictyostelium discoideum
Cyclin D associated events in G1	Dictyostelium discoideum
FBXL7 down-regulates AURKA during mitotic entry and in early mitosis	Dictyostelium discoideum
Iron uptake and transport	Dictyostelium discoideum
Neddylation	Dictyostelium discoideum
Orc1 removal from chromatin	Dictyostelium discoideum
SCF(Skp2)-mediated degradation of p27/p21	Dictyostelium discoideum
Ubiquitin-Mediated Degradation of Phosphorylated Cdc25A	Dictyostelium discoideum

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements