Envelope glycoprotein p57

Summary
UniProt ID
P52638
Gene Symbol
  • G
Organism
Borna disease virus-V
External Links
Annotation
Keyword
  • Alternative splicing
  • Clathrin-mediated endocytosis of virus by host
  • Cleavage on pair of basic residues
  • Fusion of virus membrane with host endosomal membrane
  • Glycoprotein
  • Host cell membrane
  • Host endoplasmic reticulum
  • Host-virus interaction
  • Reference proteome
  • Signal
  • Transmembrane helix
  • Viral envelope protein
Gene Ontology (GO)
Sequence
MNSKHSYVELKDKVIVPGWPTLMLEIDFVGGTSRNQFLNIPFLSVKEPLQLPREKKLTDYFTIDVEPAGHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKDQSKHAINAAFNVFSYRLRNIGVGPLGPDIRSSGP
Glycosylation Sites
Displaying entries 1 - 10 of 13 in total
Position Description PubMed ID GlyTouCan ID Source
63 N-linked (GlcNAc...) asparagine; by host
109 N-linked (GlcNAc...) asparagine; by host
139 N-linked (GlcNAc...) asparagine; by host
192 N-linked (GlcNAc...) asparagine; by host
196 N-linked (GlcNAc...) asparagine; by host
202 N-linked (GlcNAc...) asparagine; by host
221 N-linked (GlcNAc...) asparagine; by host
230 N-linked (GlcNAc...) asparagine; by host
235 N-linked (GlcNAc...) asparagine; by host
321 N-linked (GlcNAc...) asparagine; by host
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024