GlyCosmos Portal

Dynein light chain 1, cytoplasmic

UniProt ID

P63167

Gene Symbol

Organism

Homo sapiens (human)

Keyword

Displaying **all 9** entries
GO Term
apoptotic process
spermatid development
negative regulation of phosphorylation
substantia nigra development
intraciliary retrograde transport
negative regulation of DNA strand resection involved in replication fork processing
positive regulation of insulin secretion involved in cellular response to glucose stimulus
motile cilium assembly
negative regulation of nitric oxide biosynthetic process

Displaying **all 7** entries
GO Term
identical protein binding
dynein intermediate chain binding
enzyme inhibitor activity
enzyme binding
protein-containing complex binding
nitric-oxide synthase inhibitor activity
scaffold protein binding

Annotation information from UniProt.

Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
			G49108TO	GlyGen The O-GlcNAc Database

Feature

Pathway

Displaying entries **1 - 10** of 23 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
AURKA Activation by TPX2	Homo sapiens
Activation of BIM and translocation to mitochondria	Homo sapiens
Aggrephagy	Homo sapiens
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal	Homo sapiens
Anchoring of the basal body to the plasma membrane	Homo sapiens
COPI-independent Golgi-to-ER retrograde traffic	Homo sapiens
COPI-mediated anterograde transport	Homo sapiens
EML4 and NUDC in mitotic spindle formation	Homo sapiens
HCMV Early Events	Homo sapiens
HSP90 chaperone cycle for SHRs	Homo sapiens