GlyCosmos Portal

Dynein light chain 1, cytoplasmic

UniProt ID

P63168

Gene Symbol

Organism

Mus musculus (house mouse)

Keyword

Displaying **all 9** entries
GO Term
apoptotic process
regulation of mitochondrial membrane potential
intraciliary retrograde transport
negative regulation of DNA strand resection involved in replication fork processing
positive regulation of non-motile cilium assembly
mitocytosis
positive regulation of insulin secretion involved in cellular response to glucose stimulus
motile cilium assembly
negative regulation of nitric oxide biosynthetic process

Displaying **all 9** entries
GO Term
nitric-oxide synthase inhibitor activity
scaffold protein binding
protein domain specific binding
nitric-oxide synthase regulator activity
identical protein binding
dynein intermediate chain binding
enzyme inhibitor activity
enzyme binding
protein-containing complex binding

Annotation information from UniProt.

Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
			G49108TO	GlyGen The O-GlcNAc Database

Feature

Pathway

Displaying entries **1 - 10** of 22 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
AURKA Activation by TPX2	Mus musculus
Activation of BIM and translocation to mitochondria	Mus musculus
Aggrephagy	Mus musculus
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal	Mus musculus
Anchoring of the basal body to the plasma membrane	Mus musculus
COPI-independent Golgi-to-ER retrograde traffic	Mus musculus
COPI-mediated anterograde transport	Mus musculus
EML4 and NUDC in mitotic spindle formation	Mus musculus
HSP90 chaperone cycle for SHRs	Mus musculus
Intraflagellar transport	Mus musculus