GlyCosmos Portal

Submissions

Actin, alpha cardiac muscle 1

Summary

UniProt ID: P68035
Gene Symbol: Actc1 Actc
Gene ID: 29275
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P68035
The O-GlcNAc Database: P68035
O-GlcNAcAtlas: P68035
Re-Glyco: P68035

Annotation

Keyword: ATP-binding Acetylation Cytoskeleton Hydrolase Methylation Muscle protein Oxidation Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
actin filament organization	IBA	GO_REF
response to xenobiotic stimulus	IEP	PMID
positive regulation of gene expression	ISS	GO_REF
actin filament-based movement	ISO	GO_REF
skeletal muscle thin filament assembly	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

actin filament-based process [inference]

actin cytoskeleton organization [inference]

actomyosin structure organization

myofibril assembly [inference]

cardiac myofibril assembly

actin filament-based movement

actin-mediated cell contraction [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization [inference]

actomyosin structure organization

myofibril assembly [inference]

cardiac myofibril assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

myofibril assembly [inference]

cardiac myofibril assembly

cellular component assembly [inference]

cellular component assembly involved in morphogenesis [inference]

myofibril assembly [inference]

cardiac myofibril assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

myofibril assembly [inference]

cardiac myofibril assembly

supramolecular fiber organization [inference]

actin filament organization

skeletal muscle thin filament assembly

myofibril assembly [inference]

cardiac myofibril assembly

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

muscle contraction [inference]

striated muscle contraction [inference]

cardiac muscle contraction

circulatory system process [inference]

heart process [inference]

heart contraction

tissue migration [inference]

mesenchyme migration

developmental process [inference]

anatomical structure morphogenesis [inference]

tissue morphogenesis [inference]

muscle tissue morphogenesis [inference]

cardiac muscle tissue morphogenesis

anatomical structure formation involved in morphogenesis [inference]

cellular component assembly involved in morphogenesis [inference]

myofibril assembly [inference]

cardiac myofibril assembly

response to stimulus [inference]

response to chemical [inference]

response to xenobiotic stimulus

response to oxygen-containing compound [inference]

response to alcohol [inference]

response to ethanol

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
actin filament	ISO	GO_REF
actin filament	IBA	GO_REF
actin cytoskeleton	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

synapse

glutamatergic synapse

I band

cell projection [inference]

plasma membrane bounded cell projection [inference]

lamellipodium

actin-based cell projection [inference]

filopodium

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

cell body

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

actin filament

Displaying **all 5** entries
GO Term	Evidence Code	Reference
microfilament motor activity	ISO	GO_REF
ATP binding	ISO	GO_REF
hydrolase activity
myosin binding	ISO	GO_REF
myosin binding	IBA	GO_REF

GO Hierarchy

molecular function

cytoskeletal motor activity [inference]

microfilament motor activity

catalytic activity [inference]

hydrolase activity

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

polypeptide conformation or assembly isomerase activity [inference]

microfilament motor activity

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

myosin binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

microfilament motor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 10** entries
Position	PubMed ID	GlyTouCan ID	Source
35	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
54	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
62	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
157	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
201	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
234	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
241	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
325	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
326	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database
370	18988896 26109417 34502162 38843836	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Activation of STAT3 by cadherin engagement	Rattus norvegicus
Formation of the dystrophin-glycoprotein complex (DGC)	Rattus norvegicus
RHOA GTPase cycle	Rattus norvegicus
RHOB GTPase cycle	Rattus norvegicus
Regulation of CDH1 Function	Rattus norvegicus
Striated Muscle Contraction	Rattus norvegicus