GlyCosmos Portal

Submissions

T-cell immunoreceptor with Ig and ITIM domains

Summary

UniProt ID: P86176
Gene Symbol: Tigit Vstm3
Gene ID
Organism: Mus musculus (house mouse)

External Links

GlyGen: P86176
O-GlcNAcAtlas: P86176
Re-Glyco: P86176

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of interleukin-12 production	ISS	PMID
negative regulation of interleukin-12 production	ISO	GO_REF
negative regulation of interleukin-12 production	IBA	GO_REF
positive regulation of interleukin-10 production	ISS	PMID
positive regulation of interleukin-10 production	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

lymphocyte mediated immunity [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

cellular process [inference]

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

negative regulation of T cell activation

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of lymphocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of immune response [inference]

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of cell killing [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of immune response [inference]

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-12 production [inference]

negative regulation of interleukin-12 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-12 production [inference]

negative regulation of interleukin-12 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of cell killing [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of cell killing [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

negative regulation of T cell activation

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-12 production [inference]

negative regulation of interleukin-12 production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

negative regulation of T cell activation

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of T cell activation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IEA	GO_REF
cell surface	ISS	PMID
cell surface	ISO	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IBA	GO_REF
signaling receptor binding	IPI	PMID
signaling receptor binding	IEA	GO_REF GO_REF
signaling receptor activity	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHGWLLLVWVQGLIQAAFLATAIGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
104	N-linked (GlcNAc...) asparagine			UniProt GlyGen
246		32782141	G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements