GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Beta-glucan synthesis-associated protein SKN1

Summary

UniProt ID: P87024
Gene Symbol: SKN1
Gene ID
Organism: Candida albicans

External Links

Re-Glyco: P87024

Annotation

Keyword: Cell wall biogenesis/degradation Glycoprotein Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
(1->6)-beta-D-glucan biosynthetic process	IEA	GO_REF
fungal-type cell wall organization	IMP	PMID
fungal-type cell wall organization	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

polysaccharide biosynthetic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

carbohydrate biosynthetic process [inference]

polysaccharide biosynthetic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide biosynthetic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

glucan metabolic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

beta-glucan metabolic process [inference]

(1->6)-beta-D-glucan metabolic process [inference]

(1->6)-beta-D-glucan biosynthetic process

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

macromolecule biosynthetic process [inference]

polysaccharide biosynthetic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide biosynthetic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

glucan metabolic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

beta-glucan metabolic process [inference]

(1->6)-beta-D-glucan metabolic process [inference]

(1->6)-beta-D-glucan biosynthetic process

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

carbohydrate biosynthetic process [inference]

polysaccharide biosynthetic process [inference]

glucan biosynthetic process [inference]

beta-glucan biosynthetic process [inference]

(1->6)-beta-D-glucan biosynthetic process

cell wall organization or biogenesis [inference]

cell wall organization [inference]

fungal-type cell wall organization

fungal-type cell wall organization or biogenesis [inference]

fungal-type cell wall organization

cellular component organization or biogenesis [inference]

cellular component organization [inference]

external encapsulating structure organization [inference]

cell wall organization [inference]

fungal-type cell wall organization

Displaying **all 2** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum membrane	IEA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
glucosidase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on glycosyl bonds [inference]

hydrolase activity, hydrolyzing O-glycosyl compounds [inference]

glucosidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MERDLTYNAPKIKFTDTEGQEEHFYFNRSNNSTNDLTSHDSSSTQLQDANSRRQAPPPPPHNPFSDNSHENSTESLYQSETRFHQPLLHNDSNNSNSSIGNNRQRIPSQQHDTSSLYSASPISTSPLVSNFQSYSDNQDEMTRGKYNQNTNRSSSNYIQHSPTSAGYDRYPLKTQSSIGGSMSRIGLSSSSPSQQQQQHMYDNNSSNRSSYSPDSATDLMVYENGEFSPFGGYPASLFPLSIDEKEPDDYLHNPDPVQDAEYDKNRFLYDLKTMDKKSMNGLIAFIVMFLIAIAIFIILPVFTYTGYNPKAKNFENYEVLTRYSYPRLSAIRTSLIDPDTPEDALFWKSKNGEEWPLVFSDEFNAEGRTFYEGDDQFFTAPDLHYDATKDLEWYDPDAVTTANGTLTLRMDAFKNHGLFYRSGMIQSWNQMCFTQGKLEFSAKLPGYGNITGFWPGLWSMGNLGRPGYLASTEGVWPYTYDSCDAGITPNQSSPDGISYLPGQRLNKCTCPGEAHPNRGVGRGAPEIDALEGEIHGVIGRVSQSLQVAPYDIWYMPNYDFLEIHNSSITLMNTYAGGPFQQAISGVTMLNVTWYEYGDHQHNFQKYGYEYLNDDESGYLRWFVGDNPTFTIYSQALHPNGNVGWRKLPKEPLSLILNFGISNNWAYIDWPSLVFPSTMRVDYVRVYQPKDQINVGCDPTDFPTYDYIQQHLNVYQNVNLTKFEDGGYTFPKHKLIGC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
403	N-linked (GlcNAc...) asparagine			UniProt
449	N-linked (GlcNAc...) asparagine			UniProt
490	N-linked (GlcNAc...) asparagine			UniProt
565	N-linked (GlcNAc...) asparagine			UniProt
590	N-linked (GlcNAc...) asparagine			UniProt
718	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026