Envelope glycoprotein (Fragment)

Summary
UniProt ID
Q02076
Gene Symbol
  • env
Organism
Feline leukemia virus strain C/FA27
External Links
Annotation
Keyword
  • Cleavage on pair of basic residues
  • Disulfide bond
  • Fusion of virus membrane with host cell membrane
  • Glycoprotein
  • Host cell membrane
  • Viral attachment to host cell
  • Viral envelope protein
Gene Ontology (GO)
Sequence
PHQIYNVTWVITNVQTNTQANATSMLGTLTDAYPTLHVDLCDLVGNTWEPIVPDLRGWASYSSSKYGCKTADRKKQQQTYPFYVCPGHAPSLGPKGTHCGGAQDGFCAAWGCETTGEAWWKPTSSWDYITVKRGSSQDNSCEGKCNPLVLQFTQKGRQASWDGPKMWGLRLYRTGYDPIALFTVSRQVSTITPPQAMGPNLVLPDRKPPSRQSQTGSKVATQRPQTNESAPRSIAPTTMGPKRIGTGDRLINLVQGTYLALNATDPNKTKDCWLCLVSRPPYYEGIAILGNYSNQTNPPPSCLSIPQHKLTISEVSGQGLCIGTVPKTHQALCNETQQGHTGAHYLAAPNGTYWACNTGLTPCISMAVLNWTSDFCVLIELWPRVTYHQPEYVYTHFAKAVRFRREPISL
Glycosylation Sites
Displaying all 9 entries
Position Description PubMed ID GlyTouCan ID Source
6 N-linked (GlcNAc...) asparagine; by host
21 N-linked (GlcNAc...) asparagine; by host
227 N-linked (GlcNAc...) asparagine; by host
262 N-linked (GlcNAc...) asparagine; by host
267 N-linked (GlcNAc...) asparagine; by host
294 N-linked (GlcNAc...) asparagine; by host
334 N-linked (GlcNAc...) asparagine; by host
350 N-linked (GlcNAc...) asparagine; by host
370 N-linked (GlcNAc...) asparagine; by host
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024