GlyCosmos Portal

Submissions

Monocyte differentiation antigen CD14

Summary

UniProt ID: Q4FJP7
Gene Symbol: Cd14
Gene ID: 12475
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005095
Re-Glyco: Q4FJP7

Annotation

Keyword: Cell membrane Disulfide bond GPI-anchor Golgi apparatus Inflammatory response Innate immunity Leucine-rich repeat Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
inflammatory response
response to magnesium ion	IEA	GO_REF
positive regulation of interleukin-8 production	IEA	GO_REF
positive regulation of tumor necrosis factor production
toll-like receptor 4 signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response [inference]

innate immune response

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to lipoteichoic acid

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

cellular response to lipoteichoic acid

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to bacterial lipoprotein [inference]

response to bacterial lipopeptide [inference]

cellular response to bacterial lipopeptide [inference]

response to diacyl bacterial lipopeptide [inference]

cellular response to diacyl bacterial lipopeptide

response to triacyl bacterial lipopeptide [inference]

cellular response to triacyl bacterial lipopeptide

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

response to lipoteichoic acid [inference]

cellular response to lipoteichoic acid

cellular response to molecule of bacterial origin [inference]

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

cellular response to lipoteichoic acid

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to bacterial lipoprotein [inference]

response to bacterial lipopeptide [inference]

cellular response to bacterial lipopeptide [inference]

response to diacyl bacterial lipopeptide [inference]

cellular response to diacyl bacterial lipopeptide

response to triacyl bacterial lipopeptide [inference]

cellular response to triacyl bacterial lipopeptide

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

response to lipoteichoic acid [inference]

cellular response to lipoteichoic acid

cellular response to molecule of bacterial origin [inference]

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

cellular response to lipoteichoic acid

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

cellular response to lipoteichoic acid

response to abiotic stimulus [inference]

response to electrical stimulus

response to chemical [inference]

response to metal ion [inference]

response to magnesium ion

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to lipoteichoic acid

response to peptide [inference]

response to cytokine [inference]

response to tumor necrosis factor

response to oxygen-containing compound [inference]

response to lipoteichoic acid [inference]

cellular response to lipoteichoic acid

response to alcohol [inference]

response to ethanol

cellular response to oxygen-containing compound [inference]

cellular response to lipoteichoic acid

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to lipoteichoic acid

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to bacterial lipoprotein [inference]

cellular response to bacterial lipopeptide [inference]

cellular response to lipoteichoic acid

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway [inference]

cell surface toll-like receptor signaling pathway [inference]

toll-like receptor 4 signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-8 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

Displaying **all 5** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
Golgi apparatus	IEA	GO_REF GO_REF
external side of plasma membrane	IEA	GO_REF
membrane raft	IEA	GO_REF GO_REF
lipopolysaccharide receptor complex	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

lipopolysaccharide receptor complex

membrane protein complex [inference]

lipopolysaccharide receptor complex

cellular anatomical structure [inference]

membrane [inference]

membrane microdomain [inference]

membrane raft

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
lipopolysaccharide binding	IEA	GO_REF
lipopolysaccharide immune receptor activity	IEA	GO_REF
lipoteichoic acid binding	IEA	GO_REF
molecular carrier activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

lipopolysaccharide binding

carbohydrate derivative binding [inference]

molecular transducer activity [inference]

signaling receptor activity [inference]

pattern recognition receptor activity [inference]

lipopolysaccharide immune receptor activity

molecular carrier activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLFV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
180				GlycoProtDB
276				GlycoProtDB
317				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements