GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Peptidyl-prolyl cis-trans isomerase

Summary

UniProt ID: Q5SVY2
Gene Symbol: Ppia
Gene ID: 268373
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005361
Re-Glyco: Q5SVY2

Annotation

Keyword: Acetylation Apoptosis Cytoplasm Isopeptide bond Nucleus Phosphoprotein Rotamase Secreted Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein folding	IEA	GO_REF
apoptotic process
neutrophil chemotaxis
negative regulation of stress-activated MAPK cascade
lipid droplet organization

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

cell activation [inference]

endothelial cell activation

protein folding

cell death [inference]

programmed cell death [inference]

apoptotic process

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cell adhesion molecule production

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

lipid droplet organization

multicellular organismal process [inference]

cell activation [inference]

endothelial cell activation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

response to stimulus [inference]

response to stress [inference]

response to oxidative stress [inference]

cellular response to oxidative stress

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of viral process [inference]

positive regulation of viral genome replication

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of viral process [inference]

negative regulation of viral life cycle

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

regulation of viral process [inference]

positive regulation of viral process [inference]

positive regulation of viral genome replication

negative regulation of viral process [inference]

negative regulation of viral life cycle

regulation of viral life cycle [inference]

regulation of viral genome replication [inference]

positive regulation of viral genome replication

negative regulation of viral life cycle

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein polyubiquitination [inference]

regulation of protein K48-linked ubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein polyubiquitination [inference]

regulation of protein K48-linked ubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
nucleus	IEA	GO_REF
cytoplasm	IEA	GO_REF
protein-containing complex

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 2** entries
GO Term	Evidence Code	Reference
peptidyl-prolyl cis-trans isomerase activity	IEA	GO_REF GO_REF GO_REF
heparan sulfate binding

GO Hierarchy

molecular function

catalytic activity [inference]

isomerase activity [inference]

cis-trans isomerase activity [inference]

peptidyl-prolyl cis-trans isomerase activity

catalytic activity, acting on a protein [inference]

peptidyl-prolyl cis-trans isomerase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

organic acid binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparan sulfate binding

sulfur compound binding [inference]

heparan sulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
108				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026