Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Advanced glycosylation end product-specific receptor
Summary
- UniProt ID
- Q62151
- Gene Symbol
- Ager Rage
- Gene ID
- 11596
- Organism
- Mus musculus (house mouse)
External Links
- GlycoProtDB
- GPDB0005568
- PubChem
- Q62151
- RaftProt
- Q62151
- Re-Glyco
- Q62151
Annotation
- Keyword
- 3D-structure Alternative splicing Cell membrane Cell projection DNA repair DNA replication DNA-binding Disulfide bond Endosome Glycoprotein Immunoglobulin domain Inflammatory response Nucleus Phagocytosis Phosphoprotein RNA-binding Receptor Reference proteome Repeat Secreted Signal Transmembrane helix Ubl conjugation
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| response to hypoxia | ||
| microglial cell activation | ||
| microglial cell activation | ||
| microglial cell activation | ||
| microglial cell activation |
GO Hierarchy
- positive regulation of reactive oxygen species metabolic process
- positive regulation of reactive oxygen species metabolic process
- positive regulation of reactive oxygen species metabolic process
biological process
cellular process [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process [inference]
regulation of signaling [inference]
regulation of locomotion [inference]
positive regulation of biological process [inference]
positive regulation of immune system process [inference]
positive regulation of signaling
positive regulation of locomotion [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of cell communication [inference]
positive regulation of response to stimulus [inference]
positive regulation of multicellular organismal process [inference]
negative regulation of biological process [inference]
regulation of response to stimulus [inference]
regulation of developmental process [inference]
regulation of cellular process [inference]
regulation of cell communication [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
regulation of cytokine production [inference]
positive regulation of gene expression
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
regulation of cytokine production [inference]
positive regulation of gene expression
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
regulation of cell adhesion [inference]
regulation of cell population proliferation [inference]
regulation of programmed cell death [inference]
regulation of cell differentiation [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of cell communication [inference]
negative regulation of cellular process [inference]
regulation of cell activation [inference]
regulation of cell motility [inference]
regulation of multicellular organismal process [inference]
regulation of cytokine production [inference]
regulation of cell activation [inference]
positive regulation of multicellular organismal process [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| fibrillar center | ||
| phagocytic cup | ||
| phagocytic cup | ||
| phagocytic cup | ||
| extracellular region |
GO Hierarchy
| GO Term | Evidence Code | Reference |
|---|---|---|
| amyloid-beta binding | ||
| amyloid-beta binding | ||
| DNA binding | ||
| DNA binding | ||
| DNA binding |
GO Hierarchy
Sequence
MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALALGILGGLGVVALLVGAILWRKRQPRREERKAPESQEDEEERAELNQSEEAEMPENGAGGP
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 25 |
|
|
||
| 80 |
|
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Advanced glycosylation endproduct receptor signaling | Mus musculus |
| TAK1-dependent IKK and NF-kappa-B activation | Mus musculus |
| TRAF6 mediated NF-kB activation | Mus musculus |
