GlyCosmos Portal

Submissions

Tumor necrosis factor ligand superfamily member 6

Summary

UniProt ID: Q861W5
Gene Symbol: FASLG FASL TNFSF6
Gene ID: 493945
Organism: Felis catus (domestic cat)

External Links

Re-Glyco: Q861W5

Annotation

Keyword: Apoptosis Cell membrane Cytokine Cytoplasmic vesicle Disulfide bond Glycoprotein Lysosome Nucleus Reference proteome Repressor Secreted Signal-anchor Transcription regulation Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	ISS	GO_REF
negative regulation of transcription by RNA polymerase II	IEA	GO_REF
immune response	IEA	GO_REF
extrinsic apoptotic signaling pathway via death domain receptors	IBA	GO_REF
extrinsic apoptotic signaling pathway via death domain receptors	IEA	GO_REF GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway via death domain receptors

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway via death domain receptors

necroptotic signaling pathway

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

leukocyte apoptotic process [inference]

lymphocyte apoptotic process [inference]

T cell apoptotic process

programmed cell death involved in cell development [inference]

retinal cell programmed cell death

intercellular transport [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

retinal cell programmed cell death

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

cellular component organization or biogenesis [inference]

cellular component organization [inference]

membrane organization [inference]

regulation of membrane lipid distribution [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

developmental process [inference]

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

retinal cell programmed cell death

response to stimulus [inference]

immune response

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

calcium ion transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

intercellular transport [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phospholipid transport [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of lipid localization [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phospholipid transport [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of endothelial cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway via death domain receptors

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway via death domain receptors

necroptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of endothelial cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of endothelial cell apoptotic process [inference]

positive regulation of endothelial cell apoptotic process

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of endothelial cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of endothelial cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of plasma membrane organization [inference]

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of biological quality [inference]

regulation of membrane lipid distribution [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleus	ISS	GO_REF
nucleus	IEA	GO_REF GO_REF
external side of plasma membrane	IEA	GO_REF
lysosomal lumen	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen

intracellular organelle lumen [inference]

vacuolar lumen [inference]

lysosomal lumen

cytoplasmic vesicle lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

side of membrane [inference]

external side of plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF
tumor necrosis factor receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

tumor necrosis factor receptor superfamily binding [inference]

tumor necrosis factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPPPLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQKHVASSLEKQIGQLNPPSEKRELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGGLVINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKMMNYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
183	N-linked (GlcNAc...) asparagine	UniProt
249	N-linked (GlcNAc...) asparagine	UniProt
259	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements