GlyCosmos Portal

Submissions

Reticulon-4 receptor-like 1

Summary

UniProt ID: Q8K0S5
Gene Symbol: Rtn4rl1 Ngrl2
Gene ID: 237847
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0006739

GlyConnect

Reticulon-4 receptor-like 1

GlyGen

Q8K0S5

Re-Glyco

Q8K0S5

Annotation

Keyword: Cell membrane Cell projection GPI-anchor Heparin-binding Leucine-rich repeat Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
axon guidance	IBA	GO_REF
negative regulation of neuron projection development	IMP	PMID
negative regulation of neuron projection development	IEA	GO_REF
corpus callosum development	IMP	PMID
corpus callosum development	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

corpus callosum development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

negative chemotaxis

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of axon regeneration

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

negative regulation of response to wounding [inference]

negative regulation of axon regeneration

negative regulation of developmental process [inference]

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of axon regeneration

regulation of axon regeneration [inference]

negative regulation of axon regeneration

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of axon regeneration

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

negative regulation of response to wounding [inference]

negative regulation of axon regeneration

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of neuron projection regeneration [inference]

regulation of axon regeneration [inference]

negative regulation of axon regeneration

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of response to wounding [inference]

regulation of axon regeneration [inference]

negative regulation of axon regeneration

negative regulation of response to wounding [inference]

negative regulation of axon regeneration

regulation of developmental process [inference]

negative regulation of developmental process [inference]

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of neuron projection regeneration [inference]

regulation of axon regeneration [inference]

negative regulation of axon regeneration

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of cellular process [inference]

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

negative regulation of neuron projection development

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of neuron projection regeneration [inference]

regulation of axon regeneration [inference]

negative regulation of axon regeneration

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

regulation of cellular response to stress [inference]

regulation of neuron projection regeneration [inference]

regulation of axon regeneration [inference]

negative regulation of axon regeneration

negative regulation of neuron projection regeneration [inference]

negative regulation of axon regeneration

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF GO_REF
plasma membrane	EXP	PMID
plasma membrane	IEA	GO_REF GO_REF
cell surface	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

membrane microdomain [inference]

membrane raft

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
heparin binding	IMP	PMID
heparin binding	IBA	GO_REF
chondroitin sulfate binding	IDA	PMID
signaling receptor activity	ISS	GO_REF
signaling receptor activity	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

Roundabout binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

sulfur compound binding [inference]

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVPCATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKGHPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSGTALGAPLLAWILGLAVTLR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites