GlyCosmos Portal

Submissions

Rhodopsin

Summary

UniProt ID: Q95KU1
Gene Symbol: RHO OPS
Gene ID: 493762
Organism: Felis catus (domestic cat)

External Links

PubChem: Q95KU1
Re-Glyco: Q95KU1

Annotation

Keyword: Acetylation Cell projection Disulfide bond G-protein coupled receptor Glycoprotein Metal-binding Palmitate Phosphoprotein Reference proteome Retinal protein Transmembrane helix Vision Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor signaling pathway	ISS	GO_REF
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF
visual perception	IEA	GO_REF
phototransduction	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

G protein-coupled opsin signaling pathway

phototransduction

G protein-coupled opsin signaling pathway

light absorption [inference]

absorption of visible light

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

response to stimulus [inference]

response to external stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

cellular response to light stimulus

G protein-coupled opsin signaling pathway

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

detection of stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

G protein-coupled opsin signaling pathway

phototransduction

G protein-coupled opsin signaling pathway

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
photoreceptor outer segment	IBA	GO_REF
photoreceptor outer segment	IEA	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF
membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

photoreceptor outer segment

membrane

plasma membrane

organelle membrane [inference]

photoreceptor disc membrane

bounding membrane of organelle [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

photoreceptor inner segment membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
11-cis retinal binding	ISS	GO_REF
G protein-coupled photoreceptor activity	ISS	GO_REF
G protein-coupled photoreceptor activity	IBA	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

isoprenoid binding [inference]

retinoid binding [inference]

retinal binding [inference]

11-cis retinal binding

small molecule binding [inference]

vitamin binding [inference]

retinal binding [inference]

11-cis retinal binding

ion binding [inference]

cation binding [inference]

metal ion binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled photoreceptor activity

photoreceptor activity [inference]

G protein-coupled photoreceptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSIYNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTGSKTETSQVAPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites