GlyCosmos Portal

Submissions

UL16-binding protein 2

Summary

UniProt ID: Q9BZM5
Gene Symbol: ULBP2 N2DL2 RAET1H UNQ463/PRO791
Gene ID: 80328
Organism: Homo sapiens (human)

External Links

GlycoProtDB: GPDB0012547
GlyGen: Q9BZM5
The Human Metabolome Database: HMDBP07831
RaftProt: Q9BZM5
Re-Glyco: Q9BZM5

Annotation

Keyword: 3D-structure Cell membrane Direct protein sequencing Disulfide bond Endoplasmic reticulum GPI-anchor Host-virus interaction Immunity Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of T cell mediated cytotoxicity	IBA	GO_REF
antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA	GO_REF
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA	GO_REF
immune response
natural killer cell activation	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

lymphocyte mediated immunity [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

antigen processing and presentation [inference]

antigen processing and presentation via MHC class Ib [inference]

antigen processing and presentation of peptide antigen via MHC class Ib [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous antigen [inference]

antigen processing and presentation of endogenous peptide antigen [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

antigen processing and presentation of peptide antigen [inference]

antigen processing and presentation of peptide antigen via MHC class Ib [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

antigen processing and presentation of endogenous peptide antigen [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

leukocyte activation [inference]

lymphocyte activation [inference]

natural killer cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

natural killer cell activation

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

natural killer cell activation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of lymphocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of cellular process [inference]

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID
extracellular region	TAS	Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

side of membrane [inference]

external side of plasma membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
GPI anchor binding	IDA	PMID
natural killer cell lectin-like receptor binding	IDA	PMID
natural killer cell lectin-like receptor binding	IBA	GO_REF
receptor ligand activity	IDA	PMID
receptor ligand activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

natural killer cell lectin-like receptor binding

lipid binding [inference]

phospholipid binding [inference]

GPI anchor binding

glycolipid binding [inference]

GPI anchor binding

carbohydrate derivative binding [inference]

glycolipid binding [inference]

GPI anchor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
68	N-linked (GlcNAc...) asparagine	23090970 24190977	G83460ZZ	GlycoProtDB UniProt GlyGen
82	N-linked (GlcNAc...) asparagine	23090970 24190977	G80920RR	GlycoProtDB UniProt GlyGen