GlyCosmos Portal

Submissions

Platelet glycoprotein VI

Summary

UniProt ID: Q9HCN6
Gene Symbol: GP6
Gene ID: 51206
Organism: Homo sapiens (human)

External Links

GlyGen: Q9HCN6
PubChem: Q9HCN6
The Human Metabolome Database: HMDBP13518
RaftProt: Q9HCN6
Re-Glyco: Q9HCN6

Annotation

Keyword: 3D-structure Alternative splicing Blood coagulation Cell membrane Direct protein sequencing Disease variant Disulfide bond Glycoprotein Immunoglobulin domain Proteomics identification Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response-regulating signaling pathway
enzyme-linked receptor protein signaling pathway	TAS	PMID
platelet activation	NAS	PMID
collagen-activated tyrosine kinase receptor signaling pathway	IBA	GO_REF
collagen-activated signaling pathway	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

platelet activation

cell adhesion [inference]

cell-cell adhesion [inference]

homotypic cell-cell adhesion [inference]

platelet aggregation

signal transduction [inference]

immune response-regulating signaling pathway

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway

cell surface receptor protein tyrosine kinase signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

collagen-activated signaling pathway

collagen-activated tyrosine kinase receptor signaling pathway

multicellular organismal process [inference]

cell activation [inference]

platelet activation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of response to stimulus [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway

cell surface receptor protein tyrosine kinase signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

collagen-activated signaling pathway

collagen-activated tyrosine kinase receptor signaling pathway

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of homotypic cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of platelet aggregation [inference]

positive regulation of platelet aggregation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion [inference]

positive regulation of platelet aggregation

regulation of cell activation [inference]

regulation of platelet activation [inference]

regulation of platelet aggregation [inference]

positive regulation of platelet aggregation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of platelet activation [inference]

regulation of platelet aggregation [inference]

positive regulation of platelet aggregation

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IDA	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
cell surface	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

membrane microdomain [inference]

membrane raft

external encapsulating structure [inference]

extracellular matrix

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

tetraspanin-enriched microdomain

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transmembrane signaling receptor activity	TAS	PMID
transmembrane signaling receptor activity	IBA	GO_REF
collagen binding	TAS	PMID PMID
collagen binding	IEA	GO_REF
signaling receptor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding

protein-containing complex binding [inference]

collagen binding

molecular transducer activity [inference]

signaling receptor activity

transmembrane signaling receptor activity

collagen receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
92	N-linked (GlcNAc...) asparagine	16014566		UniProt GlyGen
208				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Cell surface interactions at the vascular wall	Homo sapiens
GPVI-mediated activation cascade	Homo sapiens
Platelet Adhesion to exposed collagen	Homo sapiens

Disease

Displaying **all 6** entries
DO ID	Disease Name	Source
DOID:2218	blood platelet disease	Alliance of Genome Resources
DOID:5844	myocardial infarction	Alliance of Genome Resources
DOID:9352	type 2 diabetes mellitus	Alliance of Genome Resources
DOID:11847	coronary thrombosis	Alliance of Genome Resources
DOID:0111057	platelet-type bleeding disorder 11	Alliance of Genome Resources
DOID:9408	acute myocardial infarction	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements