GlyCosmos Portal

Submissions

1-acylglycerol-3-phosphate O-acyltransferase PNPLA3

Summary

UniProt ID: Q9NST1
Gene Symbol: PNPLA3 ADPN C22orf20
Gene ID: 80339
Organism: Homo sapiens (human)

External Links

GlyGen

Q9NST1

PubChem

Q9NST1

SwissLipids

SLP:000000282

The Human Metabolome Database

HMDBP00232

Re-Glyco

Q9NST1

Annotation

Keyword: Acyltransferase Alternative splicing Disease variant Glycoprotein Hydrolase Lipid droplet Obesity Phospholipid biosynthesis Proteomics identification Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
long-chain fatty acid metabolic process	IDA	PMID
long-chain fatty acid metabolic process	IEA	GO_REF
glycerophospholipid metabolic process	IDA	PMID
phosphatidic acid biosynthetic process	IDA	PMID
phosphatidic acid biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

catabolic process [inference]

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process [inference]

acylglycerol acyl-chain remodeling

triglyceride acyl-chain remodeling

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

phospholipid metabolic process [inference]

glycerophospholipid metabolic process

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process [inference]

acylglycerol acyl-chain remodeling

triglyceride acyl-chain remodeling

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerophospholipid metabolic process

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

triglyceride biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

small molecule metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process

cellular developmental process [inference]

cell differentiation [inference]

fat cell differentiation [inference]

white fat cell differentiation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus [inference]

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

lipid droplet organization

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

fat cell differentiation [inference]

white fat cell differentiation

homeostatic process [inference]

chemical homeostasis [inference]

lipid homeostasis

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

response to peptide hormone [inference]

response to insulin [inference]

cellular response to insulin stimulus

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

response to chemical [inference]

response to acid chemical [inference]

response to amino acid [inference]

cellular response to amino acid stimulus [inference]

cellular response to 3,3',5-triiodo-L-thyronine

response to 3,3',5-triiodo-L-thyronine [inference]

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to acid chemical [inference]

cellular response to amino acid stimulus [inference]

cellular response to 3,3',5-triiodo-L-thyronine

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

response to peptide hormone [inference]

response to insulin [inference]

cellular response to insulin stimulus

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus [inference]

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

response to nitrogen compound [inference]

response to peptide hormone [inference]

response to insulin [inference]

cellular response to insulin stimulus

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

response to 3,3',5-triiodo-L-thyronine [inference]

cellular response to 3,3',5-triiodo-L-thyronine

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to disaccharide [inference]

response to sucrose

response to peptide hormone [inference]

response to insulin [inference]

cellular response to insulin stimulus

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

response to 3,3',5-triiodo-L-thyronine [inference]

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus [inference]

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to insulin stimulus

cellular response to 3,3',5-triiodo-L-thyronine

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm
endoplasmic reticulum membrane	TAS	Reactome Reactome Reactome Reactome
lipid droplet	IDA	PMID PMID PMID
lipid droplet	IBA	GO_REF
lipid droplet	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

lipid droplet

intracellular organelle [inference]

intracellular membraneless organelle [inference]

lipid droplet

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
1-acylglycerol-3-phosphate O-acyltransferase activity	EXP	PMID
1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	PMID
1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	GO_REF GO_REF GO_REF GO_REF
lipoprotein lipase activity	TAS	Reactome
A2-type glycerophospholipase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

acyltransferase activity, transferring groups other than amino-acyl groups [inference]

acylglycerol O-acyltransferase activity

lysophospholipid acyltransferase activity [inference]

lysophosphatidic acid acyltransferase activity

1-acylglycerol-3-phosphate O-acyltransferase activity

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

triacylglycerol lipase activity

lipoprotein lipase activity

phospholipase activity [inference]

glycerophospholipase activity [inference]

A2-type glycerophospholipase activity

carboxylic ester hydrolase activity [inference]

A2-type glycerophospholipase activity

triacylglycerol lipase activity

lipoprotein lipase activity

binding [inference]

lipid binding [inference]

phospholipid binding [inference]

lysophosphatidic acid binding

fatty acid derivative binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

lysophosphatidic acid binding

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

heterocyclic compound binding [inference]

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

carbohydrate derivative binding [inference]

lysophosphatidic acid binding

nucleoside phosphate binding [inference]

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

sulfur compound binding [inference]

acyl-CoA binding [inference]

fatty-acyl-CoA binding [inference]

long-chain fatty acyl-CoA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
89	N-linked (GlcNAc...) asparagine			UniProt GlyGen
280	N-linked (GlcNAc...) asparagine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Acyl chain remodeling of DAG and TAG	Homo sapiens

Disease

Displaying **all 6** entries
DO ID	Disease Name	Source
DOID:3393	coronary artery disease	Alliance of Genome Resources
DOID:5082	liver cirrhosis	Alliance of Genome Resources
DOID:684	hepatocellular carcinoma	Alliance of Genome Resources
DOID:0080208	metabolic dysfunction-associated steatotic liver disease	Alliance of Genome Resources
DOID:9452	steatotic liver disease	Alliance of Genome Resources
DOID:9352	type 2 diabetes mellitus	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements