GlyCosmos Portal

Submissions

Interleukin-19

Summary

UniProt ID: Q9UHD0
Gene Symbol: IL19 ZMDA1
Gene ID: 29949
Organism: Homo sapiens (human)

External Links

PubChem: Q9UHD0
Re-Glyco: Q9UHD0

Annotation

Keyword: 3D-structure Alternative splicing Apoptosis Cytokine Direct protein sequencing Disulfide bond Glycoprotein Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
apoptotic process
immune response	NAS	PMID
immune response	IBA	GO_REF
signal transduction	NAS	PMID
negative regulation of low-density lipoprotein particle clearance	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

signal transduction

metabolic process [inference]

reactive oxygen species metabolic process

cell death [inference]

programmed cell death [inference]

apoptotic process

response to stimulus [inference]

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of multicellular organismal process [inference]

negative regulation of lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of multicellular organismal process [inference]

regulation of lipoprotein particle clearance [inference]

negative regulation of lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

regulation of low-density lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

negative regulation of multicellular organismal process [inference]

negative regulation of lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

Displaying **all 5** entries
GO Term	Evidence Code	Reference
extracellular region	NAS	PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	TAS	PMID
cytokine activity	IDA	PMID
cytokine activity	IBA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
56	N-linked (GlcNAc...) asparagine			UniProt
135	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Interleukin-20 family signaling	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements