GlyCosmos Portal

Submissions

Acyl-protein thioesterase 2

Summary

UniProt ID: Q9WTL7
Gene Symbol: Lypla2
Gene ID: 26394
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9WTL7
PubChem: Q9WTL7
The Human Metabolome Database: HMDBP12166
O-GlcNAcAtlas: Q9WTL7
Re-Glyco: Q9WTL7

Annotation

Keyword: Cytoplasm Direct protein sequencing Fatty acid metabolism Hydrolase Palmitate Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein depalmitoylation
fatty acid metabolic process
acylglycerol catabolic process	ISS	GO_REF
acylglycerol catabolic process	ISO	GO_REF
acylglycerol catabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process

fatty acid derivative catabolic process [inference]

icosanoid catabolic process [inference]

prostanoid catabolic process [inference]

prostaglandin catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

protein modification process [inference]

protein deacylation [inference]

protein depalmitoylation

lipoprotein metabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

macromolecule modification [inference]

protein modification process [inference]

protein deacylation [inference]

protein depalmitoylation

macromolecule deacylation [inference]

protein deacylation [inference]

protein depalmitoylation

macromolecule depalmitoylation [inference]

protein depalmitoylation

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

acylglycerol catabolic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process

fatty acid derivative catabolic process [inference]

icosanoid catabolic process [inference]

prostanoid catabolic process [inference]

prostaglandin catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

acylglycerol catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process

fatty acid derivative metabolic process [inference]

fatty acid derivative catabolic process [inference]

icosanoid catabolic process [inference]

prostanoid catabolic process [inference]

prostaglandin catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

protein modification process [inference]

protein deacylation [inference]

protein depalmitoylation

lipoprotein metabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

small molecule metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm	ISO	GO_REF
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IDA	PMID
cytoplasm	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

Golgi stack

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phosphatidylcholine lysophospholipase A1 activity	ISS	GO_REF
phosphatidylcholine lysophospholipase A1 activity	ISO	GO_REF
phosphatidylcholine lysophospholipase A1 activity	IEA	GO_REF
palmitoyl-(protein) hydrolase activity	ISO	GO_REF
palmitoyl-(protein) hydrolase activity	IDA	PMID PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity [inference]

A1-type glycerophospholipase activity [inference]

lysophospholipase A1 activity [inference]

phosphatidylcholine lysophospholipase A1 activity

thiolester hydrolase activity [inference]

palmitoyl-(protein) hydrolase activity

carboxylic ester hydrolase activity [inference]

A1-type glycerophospholipase activity [inference]

lysophospholipase A1 activity [inference]

phosphatidylcholine lysophospholipase A1 activity

palmitoyl hydrolase activity [inference]

palmitoyl-(protein) hydrolase activity

catalytic activity, acting on a protein [inference]

palmitoyl-(protein) hydrolase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites