GlyCosmos Portal

Submissions

Solute carrier family 22 member 1

Summary

UniProt ID: O15245
Gene Symbol: SLC22A1 OCT1
Gene ID: 6580
Organism: Homo sapiens (human)

External Links

PubChem: O15245
The Human Metabolome Database: HMDBP02574
Re-Glyco: O15245

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Glycoprotein Ion transport Phosphoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
xenobiotic metabolic process	TAS	Reactome
neurotransmitter transport	IDA	PMID
obsolete serotonin transport
establishment or maintenance of transmembrane electrochemical gradient	IEA	GO_REF
obsolete organic cation transport

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

xenobiotic metabolic process

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

vitamin transmembrane transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

purine-containing compound transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

O-acyl-L-carnitine transmembrane transport

cellular detoxification

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

vascular transport [inference]

transport across blood-brain barrier

xenobiotic transport across blood-brain barrier

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

tissue development [inference]

epithelium development [inference]

renal tubule development [inference]

nephron tubule development [inference]

proximal tubule development [inference]

metanephric proximal tubule development

metanephric nephron tubule development [inference]

metanephric proximal tubule development

kidney epithelium development [inference]

nephron epithelium development [inference]

nephron tubule development [inference]

proximal tubule development [inference]

metanephric proximal tubule development

metanephric nephron tubule development [inference]

metanephric proximal tubule development

metanephric nephron epithelium development [inference]

metanephric nephron tubule development [inference]

metanephric proximal tubule development

metanephric epithelium development [inference]

metanephric tubule development [inference]

metanephric nephron tubule development [inference]

metanephric proximal tubule development

metanephric nephron epithelium development [inference]

metanephric nephron tubule development [inference]

metanephric proximal tubule development

tube development [inference]

renal tubule development [inference]

nephron tubule development [inference]

proximal tubule development [inference]

metanephric proximal tubule development

metanephric nephron tubule development [inference]

metanephric proximal tubule development

metanephric tubule development [inference]

metanephric nephron tubule development [inference]

metanephric proximal tubule development

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

neurotransmitter transport

neurotransmitter uptake [inference]

neurotransmitter reuptake [inference]

serotonin uptake

lipid transport [inference]

fatty acid transport [inference]

prostaglandin transport

vascular transport [inference]

transport across blood-brain barrier

xenobiotic transport across blood-brain barrier

organic acid transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport [inference]

prostaglandin transport

icosanoid transport [inference]

prostaglandin transport

organic hydroxy compound transport [inference]

serotonin uptake

catecholamine uptake [inference]

dopamine uptake

xenobiotic transport

xenobiotic transport across blood-brain barrier

vitamin transport [inference]

thiamine transport

thiamine transmembrane transport

vitamin transmembrane transport [inference]

thiamine transmembrane transport

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

vitamin transmembrane transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

purine-containing compound transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

O-acyl-L-carnitine transmembrane transport

nitrogen compound transport [inference]

quaternary ammonium group transport

O-acyl-L-carnitine transmembrane transport

polyamine transport [inference]

acetylcholine transport

thiamine transport

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

catecholamine uptake [inference]

dopamine uptake

sulfur compound transport [inference]

thiamine transport

thiamine transmembrane transport

import into cell [inference]

neurotransmitter uptake [inference]

neurotransmitter reuptake [inference]

serotonin uptake

acetate ester transport [inference]

acetylcholine transport

establishment of localization in cell [inference]

neurotransmitter reuptake [inference]

serotonin uptake

detoxification [inference]

cellular detoxification

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	EXP	PMID
plasma membrane	TAS	PMID Reactome Reactome Reactome
plasma membrane	IEA	GO_REF GO_REF
basal plasma membrane	IDA	PMID
basal plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

plasma membrane region [inference]

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
acetylcholine transmembrane transporter activity	IDA	PMID
acetylcholine transmembrane transporter activity	IEA	GO_REF
neurotransmitter transmembrane transporter activity	IDA	PMID PMID PMID PMID
neurotransmitter transmembrane transporter activity	IEA	GO_REF
dopamine:sodium symporter activity	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

neurotransmitter transmembrane transporter activity

acetylcholine transmembrane transporter activity

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

solute:monoatomic cation symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

metal ion transmembrane transporter activity [inference]

sodium ion transmembrane transporter activity [inference]

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

monoatomic anion transmembrane transporter activity [inference]

chloride transmembrane transporter activity [inference]

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

polyamine transmembrane transporter activity [inference]

quaternary ammonium group transmembrane transporter activity

carnitine transmembrane transporter activity [inference]

(R)-carnitine transmembrane transporter activity

nucleobase-containing compound transmembrane transporter activity [inference]

nucleoside transmembrane transporter activity [inference]

pyrimidine nucleoside transmembrane transporter activity

toxin transmembrane transporter activity

active transmembrane transporter activity [inference]

monoamine transmembrane transporter activity

secondary active transmembrane transporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

xenobiotic transmembrane transporter activity

modified amino acid transmembrane transporter activity [inference]

carnitine transmembrane transporter activity [inference]

(R)-carnitine transmembrane transporter activity

vitamin transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

lipid transmembrane transporter activity [inference]

icosanoid transmembrane transporter activity [inference]

prostaglandin transmembrane transporter activity

acetate ester transmembrane transporter activity [inference]

acetylcholine transmembrane transporter activity

azole transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

carbohydrate derivative transmembrane transporter activity [inference]

nucleoside transmembrane transporter activity [inference]

pyrimidine nucleoside transmembrane transporter activity

sulfur compound transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
71	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Abacavir transmembrane transport	Homo sapiens
Ciprofloxacin ADME	Homo sapiens
Neurotransmitter clearance	Homo sapiens
Norepinephrine Neurotransmitter Release Cycle	Homo sapiens
Organic cation transport	Homo sapiens
SLC-mediated transport of neurotransmitters	Homo sapiens