GlyCosmos Portal

Submissions

Vasopressin V2 receptor

Summary

UniProt ID: P30518
Gene Symbol: AVPR2 ADHR DIR DIR3 V2R
Gene ID: 554
Organism: Homo sapiens (human)

External Links

GlyGen: P30518
PubChem: P30518
The Human Metabolome Database: HMDBP01725
The O-GlcNAc Database: P30518
Re-Glyco: P30518

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Diabetes insipidus Disease variant Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Phosphoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of systemic arterial blood pressure by vasopressin	IBA	GO_REF
positive regulation of systemic arterial blood pressure	IEA	GO_REF
renal water retention	TAS	PMID
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway

adenylate cyclase-activating G protein-coupled receptor signaling pathway

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

renal system process [inference]

renal water transport [inference]

renal water absorption

regulation of urine volume [inference]

negative regulation of urine volume [inference]

renal water retention

renal absorption [inference]

renal water absorption

endocrine process [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by vasopressin

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

telencephalon development

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

response to peptide [inference]

response to cytokine

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

fluid transport [inference]

water transport [inference]

renal water transport [inference]

renal water absorption

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of multicellular organismal process [inference]

positive regulation of vasoconstriction

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway

adenylate cyclase-activating G protein-coupled receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cell population proliferation [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

positive regulation of multicellular organismal process [inference]

positive regulation of vasoconstriction

regulation of biological quality [inference]

regulation of blood pressure [inference]

regulation of systemic arterial blood pressure [inference]

regulation of systemic arterial blood pressure mediated by a chemical signal [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by vasopressin

positive regulation of blood pressure [inference]

positive regulation of systemic arterial blood pressure

regulation of body fluid levels [inference]

hemostasis

regulation of urine volume [inference]

negative regulation of urine volume [inference]

renal water retention

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

positive regulation of lyase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

positive regulation of lyase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

regulation of adenylate cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
endosome	TAS	PMID
endosome	IDA	PMID
endoplasmic reticulum	TAS	PMID
Golgi apparatus	TAS	PMID
plasma membrane	EXP	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

coated vesicle membrane [inference]

clathrin-coated vesicle membrane [inference]

clathrin-coated endocytic vesicle membrane

endocytic vesicle membrane [inference]

clathrin-coated endocytic vesicle membrane

bounding membrane of organelle [inference]

coated vesicle membrane [inference]

clathrin-coated vesicle membrane [inference]

clathrin-coated endocytic vesicle membrane

endocytic vesicle membrane [inference]

clathrin-coated endocytic vesicle membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

perinuclear region of cytoplasm

Displaying **all 4** entries
GO Term	Evidence Code	Reference
vasopressin receptor activity	TAS	PMID
vasopressin receptor activity	IDA	PMID PMID PMID PMID
vasopressin receptor activity	IBA	GO_REF
vasopressin receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

vasopressin receptor activity

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

vasopressin receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
22	N-linked (GlcNAc...) asparagine			UniProt GlyGen
350		38253038	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Homo sapiens
Clathrin-mediated endocytosis	Homo sapiens
Defective AVP does not bind AVPR2 and causes neurohypophyseal diabetes insipidus (NDI)	Homo sapiens
G alpha (s) signalling events	Homo sapiens
Vasopressin regulates renal water homeostasis via Aquaporins	Homo sapiens
Vasopressin-like receptors	Homo sapiens

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:0081060	X-linked nephrogenic diabetes insipidus	Alliance of Genome Resources
DOID:0112121	nephrogenic syndrome of inappropriate antidiuresis	Alliance of Genome Resources
DOID:12387	nephrogenic diabetes insipidus	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements