GlyCosmos Portal

Submissions

Inhibin beta E chain

Summary

UniProt ID: P58166
Gene Symbol: INHBE
Gene ID: 83729
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011748

GlyConnect

Inhibin beta E chain

GlyGen

P58166

Re-Glyco

P58166

Annotation

Keyword: Cleavage on pair of basic residues Disulfide bond Glycoprotein Growth factor Hormone Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cell surface receptor protein serine/threonine kinase signaling pathway	IBA	GO_REF
negative regulation of adipose tissue development	ISS	GO_REF
negative regulation of adipose tissue development	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of developmental process [inference]

negative regulation of adipose tissue development

negative regulation of multicellular organismal process [inference]

negative regulation of adipose tissue development

regulation of developmental process [inference]

negative regulation of developmental process [inference]

negative regulation of adipose tissue development

regulation of adipose tissue development [inference]

negative regulation of adipose tissue development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of adipose tissue development

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
extracellular matrix	HDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cytokine activity	ISS	GO_REF
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF
hormone activity	IEA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
198	N-linked (GlcNAc...) asparagine	19159218 23090970 24190977 29391424 37074911	G62461SM G70232NH G06247RL G11629QQ G45395BF G08918WF G00912UN G48414YA G59626AS G80920RR	GlycoProtDB UniProt GlyGen GlyConnect
236		23584533	G57321FI	GlyGen
237		23584533	G57321FI	GlyGen
239		30459171	G43417UB	GlyGen