GlyCosmos Portal

Submissions

Mitochondrial thiamine pyrophosphate carrier

Summary

UniProt ID: Q9HC21
Gene Symbol: SLC25A19 DNC MUP1
Gene ID: 60386
Organism: Homo sapiens (human)

External Links

GlyGen: Q9HC21
PubChem: Q9HC21
The Human Metabolome Database: HMDBP11980
Re-Glyco: Q9HC21

Annotation

Keyword: Alternative splicing Antiport Disease variant Mitochondrion Neuropathy Phosphoprotein Proteomics identification Reference proteome Repeat Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
thiamine diphosphate biosynthetic process	IEA	GO_REF
deoxynucleotide transport	NAS	PMID
deoxynucleotide transport	IDA	PMID
thiamine pyrophosphate transmembrane transport	IDA	PMID
thiamine-containing compound metabolic process	TAS	Reactome

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

thiamine-containing compound metabolic process

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

sulfur compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

phosphorus metabolic process [inference]

organophosphate metabolic process [inference]

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

organophosphate biosynthetic process [inference]

thiamine diphosphate biosynthetic process

biosynthetic process [inference]

sulfur compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

pyrimidine-containing compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

organophosphate biosynthetic process [inference]

thiamine diphosphate biosynthetic process

small molecule metabolic process [inference]

vitamin metabolic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

pyrimidine-containing compound metabolic process [inference]

thiamine-containing compound metabolic process

thiamine diphosphate metabolic process [inference]

thiamine diphosphate biosynthetic process

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

pyrimidine-containing compound biosynthetic process [inference]

thiamine-containing compound biosynthetic process [inference]

thiamine diphosphate biosynthetic process

transmembrane transport [inference]

vitamin transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

localization [inference]

establishment of localization [inference]

transport [inference]

organophosphate ester transport [inference]

nucleotide transport [inference]

deoxynucleotide transport

thiamine pyrophosphate transmembrane transport

vitamin transport [inference]

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

vitamin transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

transmembrane transport [inference]

vitamin transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

nitrogen compound transport [inference]

quaternary ammonium group transport [inference]

thiamine pyrophosphate transmembrane transport

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

nucleobase-containing compound transport [inference]

nucleotide transport [inference]

deoxynucleotide transport

azole transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

sulfur compound transport [inference]

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

carbohydrate derivative transport [inference]

deoxynucleotide transport

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	HDA	PMID
mitochondrion	IDA	PMID PMID GO_REF
mitochondrion	IEA	GO_REF
mitochondrion	HTP	PMID
mitochondrial inner membrane	TAS	Reactome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
thiamine transmembrane transporter activity
antiporter activity
deoxynucleotide transmembrane transporter activity	TAS	PMID
deoxynucleotide transmembrane transporter activity	IDA	PMID PMID
thiamine pyrophosphate transmembrane transporter activity	TAS	Reactome

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

organophosphate ester transmembrane transporter activity [inference]

nucleotide transmembrane transporter activity [inference]

deoxynucleotide transmembrane transporter activity

thiamine pyrophosphate transmembrane transporter activity

quaternary ammonium group transmembrane transporter activity [inference]

thiamine pyrophosphate transmembrane transporter activity

nucleobase-containing compound transmembrane transporter activity [inference]

nucleotide transmembrane transporter activity [inference]

deoxynucleotide transmembrane transporter activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

antiporter activity

vitamin transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

thiamine pyrophosphate transmembrane transporter activity

azole transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

thiamine pyrophosphate transmembrane transporter activity

sulfur compound transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

thiamine pyrophosphate transmembrane transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
12			G05962QB	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Vitamin B1 (thiamin) metabolism	Homo sapiens

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:655	inherited metabolic disorder	Alliance of Genome Resources
DOID:10907	microcephaly	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements