GlyCosmos Portal

Submissions

Vacuolar protein sorting-associated protein 4A

Summary

UniProt ID: Q9UN37
Gene Symbol: VPS4A VPS4
Gene ID: 27183
Organism: Homo sapiens (human)

External Links

GlyGen: Q9UN37
PubChem: Q9UN37
The Human Metabolome Database: HMDBP12005
RaftProt: Q9UN37
Re-Glyco: Q9UN37

Annotation

Keyword: 3D-structure ATP-binding Acetylation Cataract Cell division Congenital dyserythropoietic anemia Cytoskeleton Disease variant Endosome Hydrolase Intellectual disability Membrane Phosphoprotein Protein transport Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 54 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
actomyosin contractile ring contraction	TAS	PMID
plasma membrane repair	NAS	PMID
protein targeting to lysosome	IMP	PMID
vesicle budding from membrane	IMP	PMID
autophagy	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

metabolic process [inference]

catabolic process [inference]

autophagy

macroautophagy

microautophagy [inference]

late endosomal microautophagy

macromolecule catabolic process [inference]

protein catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

protein metabolic process [inference]

protein catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

intercellular transport [inference]

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to lysosome transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

vesicle-mediated transport

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

multivesicular body sorting pathway

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

cell cycle process [inference]

cytokinesis [inference]

cytoskeleton-dependent cytokinesis

cytokinetic process [inference]

contractile ring contraction [inference]

actomyosin contractile ring contraction

mitotic cytokinetic process [inference]

midbody abscission

mitotic cell cycle process [inference]

mitotic metaphase chromosome alignment

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

mitotic nuclear membrane organization [inference]

mitotic nuclear membrane reassembly

mitotic cytokinetic process [inference]

midbody abscission

cell division

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

protein targeting to lysosome

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to lysosome transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

process utilizing autophagic mechanism [inference]

autophagy

macroautophagy

microautophagy [inference]

late endosomal microautophagy

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

vesicle budding from membrane

vesicle fusion [inference]

endosomal vesicle fusion

endosome organization [inference]

multivesicular body organization [inference]

multivesicular body assembly

organelle fusion [inference]

organelle membrane fusion [inference]

vesicle fusion [inference]

endosomal vesicle fusion

organelle assembly [inference]

multivesicular body assembly

cellular component disassembly [inference]

protein-containing complex disassembly [inference]

protein depolymerization [inference]

vesicle uncoating

autophagosome maturation

ESCRT complex disassembly

ESCRT III complex disassembly

cellular component assembly [inference]

organelle assembly [inference]

multivesicular body assembly

membrane assembly [inference]

nuclear membrane reassembly

mitotic nuclear membrane reassembly

protein-containing complex organization [inference]

protein-containing complex disassembly [inference]

protein depolymerization [inference]

vesicle uncoating

autophagosome maturation

ESCRT complex disassembly

ESCRT III complex disassembly

membrane organization [inference]

plasma membrane organization [inference]

plasma membrane repair

membrane fusion [inference]

organelle membrane fusion [inference]

vesicle fusion [inference]

endosomal vesicle fusion

midbody abscission

membrane assembly [inference]

nuclear membrane reassembly

mitotic nuclear membrane reassembly

nuclear membrane organization [inference]

nuclear membrane reassembly

mitotic nuclear membrane reassembly

mitotic nuclear membrane organization [inference]

mitotic nuclear membrane reassembly

membrane fission

viral process [inference]

viral release from host cell

non-lytic viral release [inference]

viral budding from plasma membrane

viral budding [inference]

biological process involved in interspecies interaction between organisms [inference]

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

exit from host cell [inference]

viral release from host cell

non-lytic viral release [inference]

viral budding from plasma membrane

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

protein localization to organelle [inference]

protein localization to vacuole [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

protein localization to lysosome [inference]

protein targeting to lysosome

establishment of localization [inference]

transport [inference]

lipid transport [inference]

sterol transport [inference]

cholesterol transport [inference]

intracellular cholesterol transport

intracellular sterol transport [inference]

intracellular cholesterol transport

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

intercellular transport [inference]

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to lysosome transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport [inference]

intracellular cholesterol transport

intracellular sterol transport [inference]

intracellular cholesterol transport

vesicle-mediated transport

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

multivesicular body sorting pathway

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

protein targeting to lysosome

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to lysosome transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

establishment of protein localization [inference]

protein targeting [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

establishment of protein localization to organelle [inference]

establishment of protein localization to vacuole [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

protein targeting to lysosome

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to lysosome transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

organelle localization [inference]

chromosome localization [inference]

metaphase chromosome alignment [inference]

mitotic metaphase chromosome alignment

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to lysosome

lysosomal transport [inference]

protein targeting to lysosome

endosome to lysosome transport [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to lysosome transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

endosome to lysosome transport via multivesicular body sorting pathway [inference]

late endosome to lysosome transport via multivesicular body sorting pathway

intracellular lipid transport [inference]

intracellular sterol transport [inference]

intracellular cholesterol transport

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization

regulation of protein localization to cell periphery [inference]

regulation of protein localization to plasma membrane

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of viral process [inference]

positive regulation of viral life cycle [inference]

positive regulation of viral budding via host ESCRT complex

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cytokinesis

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell division [inference]

negative regulation of cytokinesis

regulation of viral process [inference]

positive regulation of viral process [inference]

positive regulation of viral life cycle [inference]

positive regulation of viral budding via host ESCRT complex

regulation of viral budding via host ESCRT complex [inference]

positive regulation of viral budding via host ESCRT complex

regulation of viral life cycle [inference]

positive regulation of viral life cycle [inference]

positive regulation of viral budding via host ESCRT complex

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of exosomal secretion

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of cellular process [inference]

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cytokinesis

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell division [inference]

negative regulation of cytokinesis

regulation of cell division [inference]

regulation of cytokinesis [inference]

negative regulation of cytokinesis

negative regulation of cell division [inference]

negative regulation of cytokinesis

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

regulation of mitotic cell cycle phase transition [inference]

regulation of G2/M transition of mitotic cell cycle [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

regulation of cell cycle process [inference]

negative regulation of cell cycle process [inference]

negative regulation of cytokinesis

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

regulation of cytokinesis [inference]

negative regulation of cytokinesis

regulation of cell cycle phase transition [inference]

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

regulation of mitotic cell cycle phase transition [inference]

regulation of G2/M transition of mitotic cell cycle [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

regulation of cell cycle G2/M phase transition [inference]

regulation of G2/M transition of mitotic cell cycle [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cytokinesis

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic cytokinesis checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic cytokinesis checkpoint signaling

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

Displaying entries **1 - 5** of 30 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
spindle pole	IDA	PMID
spindle pole	IEA	GO_REF
nucleus	IDA	PMID
nuclear pore	NAS	PMID
cytoplasm	IDA	PMID PMID PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

nuclear pore

catalytic complex [inference]

ATPase complex

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

cytosol

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

late endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane

endosome membrane

late endosome membrane

midbody

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
ATP binding	IMP	PMID
ATP binding	IEA	GO_REF
ATP hydrolysis activity	ISS	GO_REF
ATP hydrolysis activity	TAS	Reactome
ATP hydrolysis activity	IMP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

ATP hydrolysis activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

protein-containing complex binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

ATP-dependent protein disaggregase activity

protein-containing complex destabilizing activity [inference]

ATP-dependent protein disaggregase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
239			G47644PP	GlyGen
313			G80920RR	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Budding and maturation of HIV virion	Homo sapiens
Endosomal Sorting Complex Required For Transport (ESCRT)	Homo sapiens
HCMV Late Events	Homo sapiens
Sealing of the nuclear envelope (NE) by ESCRT-III	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements