GlyCosmos Portal

Submissions

Survival of motor neuron-related-splicing factor 30

Summary

UniProt ID: O75940
Gene Symbol: SMNDC1 SMNR SPF30
Gene ID: 10285
Organism: Homo sapiens (human)

External Links

GlyGen: O75940
PubChem: O75940
The O-GlcNAc Database: O75940
O-GlcNAcAtlas: O75940
Re-Glyco: O75940

Annotation

Keyword: 3D-structure Acetylation Apoptosis Direct protein sequencing Nucleus Phosphoprotein Proteomics identification Reference proteome Spliceosome

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
RNA splicing, via transesterification reactions	TAS	PMID
RNA splicing, via transesterification reactions	IEA	GO_REF
mRNA processing	IEA	GO_REF
apoptotic process	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

RNA processing [inference]

mRNA processing

RNA splicing [inference]

RNA splicing, via transesterification reactions

cell death [inference]

programmed cell death [inference]

apoptotic process

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	TAS	PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
nucleoplasm	IDA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

spliceosomal complex

ribonucleoprotein complex [inference]

spliceosomal complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

Displaying **all 3** entries
GO Term	Evidence Code	Reference
RNA binding	IBA	GO_REF
RNA binding	IEA	GO_REF
RNA binding	HDA	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

RNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
222		28411811 34019948 35132862 38665916 40596516	G49108TO	GlyGen The O-GlcNAc Database
227		28411811 34019948 35132862 38665916 40596516	G49108TO	GlyGen The O-GlcNAc Database