GlyCosmos Portal

Submissions

Peptidyl-prolyl cis-trans isomerase A

Summary

UniProt ID: P62937
Gene Symbol: HEL-S-69p PPIA CYPA
Gene ID: 5478
Organism: Homo sapiens (human)

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Apoptosis Cell membrane Cytoplasm Direct protein sequencing Glycoprotein Host-virus interaction Isopeptide bond Nucleus Phosphoprotein Proteomics identification Reference proteome Rotamase Secreted Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 31 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
protein peptidyl-prolyl isomerization	IDA	PMID
negative regulation of protein phosphorylation	IDA	PMID
positive regulation of protein phosphorylation	IDA	PMID
protein folding	TAS	PMID PMID
protein folding	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

cell activation [inference]

protein folding

cell adhesion [inference]

cell-cell adhesion [inference]

homotypic cell-cell adhesion [inference]

platelet aggregation

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-proline modification [inference]

protein peptidyl-prolyl isomerization

macromolecule modification [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-proline modification [inference]

protein peptidyl-prolyl isomerization

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-proline modification [inference]

protein peptidyl-prolyl isomerization

cell death [inference]

programmed cell death [inference]

apoptotic process

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cell adhesion molecule production

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

lipid droplet organization

viral process [inference]

viral release from host cell

multicellular organismal process [inference]

cell activation [inference]

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

biological process involved in interspecies interaction between organisms [inference]

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

exit from host cell [inference]

viral release from host cell

response to stimulus [inference]

response to stress [inference]

response to oxidative stress [inference]

cellular response to oxidative stress

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of viral process [inference]

positive regulation of viral genome replication

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of viral process [inference]

negative regulation of viral life cycle

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

regulation of viral process [inference]

positive regulation of viral process [inference]

positive regulation of viral genome replication

negative regulation of viral process [inference]

negative regulation of viral life cycle

regulation of viral life cycle [inference]

regulation of viral genome replication

positive regulation of viral genome replication

negative regulation of viral life cycle

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein polyubiquitination [inference]

regulation of protein K48-linked ubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein polyubiquitination [inference]

regulation of protein K48-linked ubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of protein secretion

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF
extracellular region	HDA	PMID

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

cell junction [inference]

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

intracellular organelle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

ficolin-1-rich granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA binding	HDA	PMID PMID
peptidyl-prolyl cis-trans isomerase activity	IDA	PMID PMID
peptidyl-prolyl cis-trans isomerase activity	IMP	PMID PMID PMID PMID
peptidyl-prolyl cis-trans isomerase activity	IEA	GO_REF GO_REF GO_REF GO_REF
integrin binding	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

isomerase activity [inference]

cis-trans isomerase activity [inference]

peptidyl-prolyl cis-trans isomerase activity

catalytic activity, acting on a protein [inference]

peptidyl-prolyl cis-trans isomerase activity

binding [inference]

nucleic acid binding [inference]

RNA binding

protein binding [inference]

signaling receptor binding [inference]

integrin binding

virion binding

cell adhesion molecule binding [inference]

integrin binding

cyclosporin A binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

organic acid binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

protein-containing complex binding [inference]

integrin binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparan sulfate binding

sulfur compound binding [inference]

heparan sulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
21		20305658 21740066 23301498 28510447 29351928 29485866 32119511 33214551 34019948 34725712 35083852 35138101 37217939 38665916 40596516	G49108TO G70994MS	GlyGen The O-GlcNAc Database
71			G80920RR	GlyGen
108	N-linked (GlcNAc...) asparagine	37074911	G49906RN G27915IV G60033FS G62765YT G37995HC	GlycoProtDB UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 15 in total

1

2

Next ›

Last »
Pathway Name	Organism
APOBEC3G mediated resistance to HIV-1 infection	Homo sapiens
Assembly Of The HIV Virion	Homo sapiens
Basigin interactions	Homo sapiens
Binding and entry of HIV virion	Homo sapiens
Budding and maturation of HIV virion	Homo sapiens
Calcineurin activates NFAT	Homo sapiens
Early Phase of HIV Life Cycle	Homo sapiens
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation	Homo sapiens
Integration of provirus	Homo sapiens
Minus-strand DNA synthesis	Homo sapiens

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:526	human immunodeficiency virus infectious disease	Alliance of Genome Resources
DOID:4947	cholangiocarcinoma	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements